KEGG   Bacillus subtilis subsp. subtilis 168: BSU30820
Entry
BSU30820          CDS       T00010                                 

Gene name
menD
Definition
(RefSeq) 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase
  KO
K02551  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC:2.2.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BSU30820 (menD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     BSU30820 (menD)
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M_2 TPP_enzyme_C TPP_enzyme_M Imm57
Other DBs
NCBI-GeneID: 937198
NCBI-ProteinID: NP_390960
Pasteur: BG10683
BSORF: BG10683
UniProt: P23970 A0A6M4JLF6
Structure
PDB: 
2X7J

Position
complement(3150563..3152305)
AA seq 580 aa
MTVNPITHYIGSFIDEFALSGITDAVVCPGSRSTPLAVLCAAHPDISVHVQIDERSAGFF
ALGLAKAKQRPVLLICTSGTAAANFYPAVVEAHYSRVPIIVLTADRPHELREVGAPQAIN
QHFLFGNFVKFFTDSALPEESPQMLRYIRTLASRAAGEAQKRPMGPVHVNVPLREPLMPD
LSDEPFGRMRTGRHVSVKTGTQSVDRESLSDVAEMLAEAEKGMIVCGELHSDADKENIIA
LSKALQYPILADPLSNLRNGVHDKSTVIDAYDSFLKDDELKRKLRPDVVIRFGPMPVSKP
VFLWLKDDPTIQQIVIDEDGGWRDPTQASAHMIHCNASVFAEEIMAGLTAATRSSEWLEK
WQFVNGRFREHLQTISSEDVSFEGNLYRILQHLVPENSSLFVGNSMPIRDVDTFFEKQDR
PFRIYSNRGANGIDGVVSSAMGVCEGTKAPVTLVIGDLSFYHDLNGLLAAKKLGIPLTVI
LVNNDGGGIFSFLPQASEKTHFEDLFGTPTGLDFKHAAALYGGTYSCPASWDEFKTAYAP
QADKPGLHLIEIKTDRQSRVQLHRDMLNEAVREVKKQWEL
NT seq 1743 nt   +upstreamnt  +downstreamnt
ttgacagtcaacccgattactcattacatcggaagttttattgatgaattcgccctttcc
ggaattacggacgccgtcgtttgtccgggctcaagatctacaccgctggctgttctttgt
gctgcgcatcccgatatcagcgtccatgtccaaattgatgaaaggtctgccggatttttt
gcattaggtttggcaaaagcgaagcagcgtcccgtactattgatctgtacatctggaaca
gccgcggccaacttttatccggctgtggttgaagcccattattcaagggtgcctattatt
gtgttaactgctgatcggcctcatgagctgcgcgaagtaggcgcaccgcaggctattaat
cagcacttcttattcggtaactttgttaagtttttcacagactctgctcttcctgaagag
tctccgcaaatgctgagatacatccgaacgctggcaagccgcgctgccggagaagcacaa
aagcgcccgatggggcctgtccatgtgaatgtgccgctgcgcgaaccgctgatgccggat
ctttcagatgagccgtttggaagaatgagaacaggccgtcatgtgtctgtgaaaacgggt
acgcagtctgttgaccgagagtccctgtctgatgtggctgagatgctcgcagaggctgaa
aaaggaatgatcgtctgcggagagctccatagtgatgcggacaaggaaaacattattgcg
ctgtcaaaagcgcttcagtatccaattttagcagatccgctgtctaatctgcggaatggt
gttcatgataaaagcactgttattgatgcgtatgattcgtttttaaaagatgatgagctg
aagcggaaactccgtcctgatgttgtcattcggtttggaccgatgcctgtttcaaaaccg
gttttcttatggcttaaggatgatccgacgattcagcaaatcgtgattgacgaggatgga
gggtggagagacccgacacaggcaagcgcgcatatgattcattgtaatgcgtctgttttt
gctgaggagatcatggcaggccttactgctgccaccagatcctcagagtggctggaaaag
tggcagtttgtcaatgggcggttccgcgagcatctgcaaacaatcagcagtgaagatgtt
tcgtttgaaggcaatctctatcgaatccttcagcatcttgtgcctgaaaacagctcgctg
tttgtgggaaacagcatgccgatcagggatgttgatacgttttttgaaaagcaggaccgc
cctttccggatttattcaaaccggggagcaaacgggatagacggtgtcgtctcctctgcc
atgggggtatgtgaaggaacaaaagcgcctgttacccttgtgattggagatttatctttt
tatcatgatttaaacggcctgctggcggccaaaaagctgggtattcctcttactgtgatt
cttgtcaataatgacggaggagggattttctcctttttgccgcaggcttctgagaagaca
cactttgaagatttgttcggcacaccgacagggctcgatttcaagcatgcggctgcactt
tacggcggaacgtattcatgcccggcttcttgggatgaattcaaaacagcttacgcgccg
caggcagacaagcccggactccatttgattgaaatcaaaacggatcgccaatcaagagtc
cagcttcatcgcgatatgctgaatgaggctgtgcgggaagtgaaaaaacaatgggaactg
taa

DBGET integrated database retrieval system