KEGG   Bacillus subtilis subsp. subtilis 168: BSU30830
Entry
BSU30830          CDS       T00010                                 

Symbol
menF
Name
(RefSeq) menaquinone-specific isochorismate synthase
  KO
K02552  menaquinone-specific isochorismate synthase [EC:5.4.4.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsu01053  Biosynthesis of siderophore group nonribosomal peptides
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BSU30830 (menF)
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    BSU30830 (menF)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     BSU30830 (menF)
SSDB
Motif
Pfam: Chorismate_bind
Other DBs
NCBI-GeneID: 937190
NCBI-ProteinID: NP_390961
Pasteur: BG10682
BSORF: BG10682
UniProt: P23973 A0A6M3ZG18
Position
complement(3152302..3153717)
AA seq 471 aa
MVTTVQRTFRKEVLHALHKAKEVNHAVLISYSRQIESLDPLSFFNYGAKKYTGNRFFWSD
PESELTIVGLGKEAVFQTNQKNSERYREVFEQWERFKKTAFHIYEEEKLQHSAVGPVLFG
GFSFDPCEERGSQWDHFSEGDFFVPALMLTMTAEGPFLTVNRWVSGGEDAEAVLEGLKAF
AAEFMVPDFKQEDQAVIAAAEELDKDDWLKAIETATSQIKEKQYDKVVLARELLLTFDGP
IQIEPVLKTLLDDQQTSYVFAIEQEGKTFVGASPERLIKRDGGTVMSSCLAGSIKRGVNE
EDDRRIGLELLNDEKNLLEHDIVVGMIHNAFVSSCSEVEKPDGPVLYKTKSVQHLFTPIV
GQLRESASIFDLIEKLHPTPALGGSPQEKAVDVIREIEPMSRGWYAAPIGWIDSQDNGEF
AVAIRSGLIEGSTARLFAGCGIVEDSEPISEYEETQIKLKPMISALGGERR
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggtgacaacggtgcagcgtacgttccgaaaggaagttctacatgcattacataaagcc
aaagaagtcaaccatgctgtcttaataagctattcgagacaaatcgagtctcttgaccct
ctatcatttttcaattacggagcaaaaaaatatacaggcaatcgatttttttggtcagat
cctgaaagtgaattgacaatagtcggtcttggcaaagaagcggttttccagacaaatcaa
aaaaacagcgagcggtatcgtgaggtttttgaacaatgggagcgctttaaaaagacggct
tttcatatttatgaagaagaaaagctgcagcattctgcagtgggacctgtgttattcgga
ggattttcttttgacccttgcgaagaaagaggttcacaatgggaccatttctcggaaggg
gatttctttgtgcctgcgcttatgctgacgatgactgctgaaggcccgttcttaacagtt
aacagatgggtaagcggaggagaagacgcagaagctgttttagaaggcttaaaagctttt
gcggcggaatttatggttcccgatttcaagcaagaagatcaggctgtgattgcagcagcc
gaagagctggataaggatgattggctgaaagcaatcgaaacggccacaagccaaattaaa
gagaaacaatatgataaggttgttcttgcccgagagctgctgctcacgtttgacggtcca
atccaaattgaaccggtgcttaaaacgcttctggacgatcagcagacaagctatgttttt
gcaattgaacaagaaggcaaaacctttgtcggcgcgtctccggaaagactgatcaaaaga
gacggcggcactgtcatgtcttcctgtctggcaggctccattaaacgaggcgtgaatgaa
gaagacgaccgccggataggccttgaattattaaacgatgagaaaaacctgcttgagcat
gatattgtggtaggtatgattcataatgcttttgtatcaagctgttcagaggttgaaaag
cctgatggacctgttttgtacaaaacaaaaagcgttcagcacctgtttacgccgattgtc
ggacagctgcgcgagtctgcttcgatttttgacttaattgagaagctgcaccccactccc
gcgcttgggggatcacctcaggaaaaagctgttgacgtgatcagggagattgaaccgatg
tcccgcggctggtatgcggcccctatcggctggattgacagccaggataacggggaattc
gcggtcgccattcgttcagggctcatcgaaggaagcacagcaaggctgtttgccgggtgc
ggtattgtggaagactcggaaccaatctcggaatatgaagaaacacagattaaattgaag
ccgatgatctctgcattaggaggtgagaggcgttga

DBGET integrated database retrieval system