KEGG   Bacillus subtilis subsp. subtilis 168: BSU30840
Entry
BSU30840          CDS       T00010                                 

Gene name
yteA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: zf-dskA_traR DUF2093 Nup54_57_C DegS
Other DBs
NCBI-GeneID: 937192
NCBI-ProteinID: NP_390962
Pasteur: BG11200
BSORF: BG11200
UniProt: P42408 A0A6M3ZFD5
Position
3154007..3154726
AA seq 239 aa
MLTKEQLQHLKNELEQTKKDILNRFKDNDHFQLNSAFPYDSWGELSAYDNHPGDQATELY
EREKDIALDLHEREHLRDIEHSLKAIENGTYGICEVSGKEIPFERLEALPTATTLAEYSS
QDVVSKDRPIEEETPFGQFEFDDDEEIRAPYDSEDSYQDVEKYGNSQTPQDMENPPLSYD
DMTMNAEENIGNTESYENFIATDITGKEITVYQSRAHERYEEELDEEGIMTTFGDLHAD
NT seq 720 nt   +upstreamnt  +downstreamnt
ttgcttacgaaagaacagcttcagcatttaaaaaatgaactggaacaaacgaaaaaagat
atcttaaaccgtttcaaagacaatgatcattttcagcttaactcagcctttccttatgat
tcgtggggtgagctttcggcatacgacaaccatcccggcgatcaggcgacagaactttac
gagcgtgagaaagacatcgctctagacttgcatgagagagagcaccttcgggacattgag
cattcattgaaggcgatagaaaacggtacgtatggcatttgtgaagtcagcggaaaggaa
atccctttcgaacgacttgaagcgcttccgactgccacaaccctcgcggagtattcgtca
caggacgtggtttccaaagaccgtccgattgaagaagaaacaccattcgggcaatttgaa
tttgatgatgatgaagaaatcagagcgccatatgacagtgaggattcctatcaggatgtc
gaaaaatatgggaactcacaaacgccgcaggatatggaaaaccctccgctcagctatgat
gatatgacgatgaatgccgaagagaatatcggcaatacggagtcttacgaaaatttcatc
gctacagatatcactgggaaagaaattaccgtttatcaaagcagagcccatgagcgctat
gaagaagaacttgacgaagagggaatcatgaccacattcggcgatctccacgctgattga

DBGET integrated database retrieval system