KEGG   Bacillus subtilis subsp. subtilis 168: BSU30850Help
Entry
BSU30850          CDS       T00010                                 

Gene name
ytdA
Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00052  Galactose metabolism
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01130  Biosynthesis of antibiotics
Module
bsu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
bsu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU30850 (ytdA)
   00052 Galactose metabolism
    BSU30850 (ytdA)
   00500 Starch and sucrose metabolism
    BSU30850 (ytdA)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU30850 (ytdA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BSU30850 (ytdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 937119
NCBI-ProteinID: NP_390963
Pasteur: BG11199
BSORF: BG11199
UniProt: P42407
Position
complement(3154735..3155553)
Genome map
AA seq 272 aa AA seqDB search
MIKKAIIPAGGFGTRNLPVTKVIPKEMFPVGSKPVIHYLVEELKESGIEDILMVVSSHKN
LIVDYFDSSLALEAFLASKNKLHLLREHPIPDIRIHYVRQPYAKGLGDAISFGKQFAGGE
PFAVVLPDDLIFSANQPALGQLIEAYTKYQSSVIGLKETKTEDLHHYGVIKGEPVEKGLY
RIQDIVEKPKQNPPSHFAAAGRYIFTPDIFNELEALEADSGGEVQVTDAIKASLGACTVY
GKLLEGERYDIGLQKDYLKLIYDMLKTEKNPQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagcgatcattcctgcaggcggattcggcacgagaaatctgccggtgacg
aaggtgattccgaaagaaatgtttccggtaggatctaagcctgtgattcattatcttgtt
gaagaattaaaggagtcaggcattgaggacattttgatggttgtatcgagccataaaaat
ctgattgtcgactattttgattcctctttggcacttgaggcttttttggcctctaagaat
aaactgcatttacttagagagcatcccattccggatatacggattcactatgtgcggcag
ccttatgcaaagggtcttggcgacgccatttctttcggaaagcaatttgcaggaggagag
ccttttgccgtcgttttgccagatgatctgattttttccgccaatcagccggctttgggg
cagctgattgaagcgtatacgaaatatcagtccagtgtgatcggcttaaaagaaacaaaa
acggaggatttacatcattacggggtgataaaaggggagcctgttgaaaaagggctttat
cgcatacaggatattgtggaaaagcctaaacaaaaccctccgtctcattttgccgcagca
gggcgttatattttcacaccggatatttttaatgagctggaggcattagaagctgatagc
ggaggagaagtgcaggtaacggatgcgataaaagcttcgctcggggcatgtaccgtatac
gggaaattgctagagggcgagcggtatgacatcggcctgcaaaaggattatctgaagctg
atttacgatatgctgaaaacggaaaagaacccccaataa

DBGET integrated database retrieval system