KEGG   Bacillus subtilis subsp. subtilis 168: BSU30860
Entry
BSU30860          CDS       T00010                                 

Symbol
ytcA
Name
(RefSeq) UDP-glucose 6-dehydrogenase YtcA
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00053  Ascorbate and aldarate metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
bsu01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU30860 (ytcA)
   00053 Ascorbate and aldarate metabolism
    BSU30860 (ytcA)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU30860 (ytcA)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU30860 (ytcA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     BSU30860 (ytcA)
SSDB
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh UDPG_MGDP_dh_C NAD_binding_2 F420_oxidored 2-Hacid_dh_C ApbA Pyr_redox_2 Pyr_redox HTH_51 FAD_binding_3 NAD_Gly3P_dh_N TrkA_N 3HCDH_N Rossmann-like
Other DBs
NCBI-GeneID: 936155
NCBI-ProteinID: NP_390964
Pasteur: BG13828
BSORF: BG13828
UniProt: O34862 A0A6M4JM99
Position
3155725..3157011
AA seq 428 aa
MKICVVGAGYVGLTLSAALASIGHDMICTDKDVKKIGQLKKGVIPFYEPGLSDAILRCGN
LSFSSEVKSSMEECPVIFIAVGTPPRSDGSADTKALQSVIGDLSEAIRSYKTIITKSTVP
PGTNENIAKQLIASGVSKNLFNIVSNPEFLREGNALYDMLHPDKTVIGVQEEDHVSAAIV
KSIYKHIDTPFIVTSLAGAELIKYANNFFLAAKISFINEMARICEAYQSDISDISRAIGL
DPRIGKHFLQAGIGYGGSCFPKDLQALQFAAQEKNTETFLLRAVQHINDTQLGLYIKKIQ
SFFETLQGKKAAVLGISFKPNTDDIRNSQAVRLMERLAELGCDVHAYDPEAVLPEHLRQH
VTQHSQAFDAIEESDFLFLATEWSEFLAFDWKKAADIMKGRLVIDGRNVLKKELIEACGL
ICTGVGRP
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgaaaatttgtgtggttggcgccgggtatgtcggtttaaccctatcagcggcactggca
tccatcggacatgacatgatatgcacagacaaagacgtcaaaaaaatcgggcagctgaaa
aaaggagtcattcccttttacgagcctgggctttcagatgcaatacttcgttgcggcaat
ctctcgttttcttctgaagtgaaatcgagcatggaggaatgtcccgttatttttatcgca
gtcggaactccgccgcgttcggacggatcagctgatacgaaagccctgcagtccgtcatc
ggtgatttaagcgaggcgatccgatcgtataaaaccattattacgaaaagcactgttccg
cccgggacaaatgaaaacatagcaaaacagctgattgcctccggagtgtctaaaaacctc
tttaatatcgtatccaatccggagtttctgcgggaaggcaatgccttatatgacatgctg
catcctgacaaaacagtcatcggtgttcaggaagaagatcacgtatcggcagccatcgtc
aaatccatttacaaacacattgataccccttttatcgttacaagcttagcgggagcagag
ctgatcaaatatgccaacaatttctttttagcggccaaaatttcgttcattaacgaaatg
gcccgcatatgtgaagcctatcaatcagatatctcagatatttcccgcgctatcggtcta
gacccaaggatcgggaagcactttttgcaggcaggcatcggatacggaggctcttgtttt
ccaaaggatctgcaggcgctgcaatttgctgcccaggaaaaaaacacggagaccttcctg
ctccgggccgtgcagcacattaatgacacccagcttggcctgtatatcaaaaaaatacag
tcattcttcgaaacacttcaaggcaagaaagcggctgtactcggcatttccttcaaaccg
aatactgatgacatccggaattctcaggctgtcagactgatggaaaggctggcggagctg
ggatgtgatgttcatgcatatgatcctgaagctgtacttccagaacatttgcggcaacat
gtaactcagcattctcaagcttttgatgcgatcgaagagagtgactttttatttttggcg
acagaatggtctgagtttttagcgtttgattggaaaaaggctgcagatatcatgaaaggg
cgtcttgtgattgacggacgcaacgtactaaaaaaagaactgatcgaggcttgcggcctg
atctgtacgggagttggccgtccatga

DBGET integrated database retrieval system