KEGG   Bacillus subtilis subsp. subtilis 168: BSU30880
Entry
BSU30880          CDS       T00010                                 

Symbol
ytcC
Name
(RefSeq) glycosyltransferase YtcC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_1_2 DUF6221
Other DBs
NCBI-GeneID: 939212
NCBI-ProteinID: NP_390966
Pasteur: BG13830
BSORF: BG13830
UniProt: O34413 A0A6M3ZFM2
Position
3157961..3159184
AA seq 407 aa
MKLAFICTEKLPAPAVRGGAIQMMIDGVTPYFSSRYDLTIFSIEDPSLPKRETKDGVHYI
HLPKEHYREAVAEELRASSFDLIHVFNRPLNVSLYKKASPNSKIVLSLHNEMFSEKKMTF
AQGKEVLDNVSMITTVSEFIKQTVIERFPEAEDITKVVYSGVDLNSYPPVWTMKGSAVRK
TYRKKYGIEDKKVILFAGRLSPTKGPHLLIHSMRRILQQHPDAVLVIAGGKWFSDDSENQ
YVTYLRTLALPYRDHIIFTKFIPADDIPNLFLMADVFVCSSQWNEPLARVNYEAMAAGTP
LITTNRGGNGEVVKHEVTGLVIDSYNKPSSFAKAIDRAFTDQELMNKMTKNARKHVEALF
TFTHAAKRLNTVYQSVLTPKNKQFPPPFLTQNFDLSSINQLFVKAKT
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgaagcttgcctttatctgtacagaaaagctgccggcgcccgcagtacgcggcggcgct
attcaaatgatgattgacggtgtcacgccctatttcagcagcaggtacgacctgaccatt
ttttcaatagaagatccatcgctcccaaaaagagaaacaaaagacggcgtacattatatc
catctgccaaaagaacattaccgcgaggcggtagccgaagagctgcgagcctcttccttt
gacctcattcatgtgttcaacaggcctttaaatgtctctttatataaaaaagcctcacca
aacagcaagatcgttctgagcctgcataacgaaatgttttctgaaaaaaagatgaccttc
gcgcaaggaaaagaagtactcgacaatgtctccatgatcacaacagtgagcgaatttatt
aaacaaaccgtcattgaacgtttccctgaagccgaggacatcacaaaagttgtgtattcc
ggcgttgatttaaactcttatccgcccgtctggacgatgaaaggctcggctgtcagaaaa
acataccggaaaaaatacggtattgaagataaaaaagttattttattcgccggccgctta
agcccgacaaaagggcctcaccttctcattcacagcatgagacggattttgcagcagcac
cctgatgctgtactggtcatagcaggcgggaagtggttcagcgatgacagcgaaaaccaa
tatgtcacctatctgcgcacgctggcgctgccatacagagaccacataatctttacaaaa
ttcattcccgcagacgatatcccaaacctttttctgatggcagatgtatttgtgtgcagc
tctcagtggaacgaacccctcgcccgtgtgaattatgaagcaatggcggccggcacgccc
ttaattaccacaaaccggggcggaaacggtgaagtcgtaaaacacgaagtcaccggcctt
gtcatcgatagctacaacaaaccttcttcatttgcaaaagcaattgacagagcctttaca
gatcaagaattaatgaacaaaatgacaaaaaacgcccgaaagcatgtagaagctttattt
acctttacccatgctgccaaaaggctcaatactgtttaccaatccgttctgaccccgaaa
aacaaacaatttccgccgccttttctgacgcaaaattttgatttatcatctatcaatcag
ctttttgtgaaagcaaaaacataa

DBGET integrated database retrieval system