KEGG   Bacillus subtilis subsp. subtilis 168: BSU30890
Entry
BSU30890          CDS       T00010                                 

Symbol
ytxO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Rrn6
Other DBs
NCBI-GeneID: 936317
NCBI-ProteinID: NP_390967
Pasteur: BG11382
BSORF: BG11382
UniProt: P46916 A0A6M4JNZ2
Position
complement(3159258..3159689)
AA seq 143 aa
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSISAEKEEEEKHLDVGSIRELPHINAPK
EYQKETKEKETDRKIVDDEEETKFETTLEPEEERDSKRSAPPYEEEDEDEEPDLAEEAKV
EIIILPSESKPAPWFSQTVKRKA
NT seq 432 nt   +upstreamnt  +downstreamnt
atgaggtcatcgagacaaaaagcctctatttctaaactggatctcgaccaattcgtattt
acaccgcctggaccgatgggatggcaggctcatgactcaatctcagctgagaaggaagaa
gaggagaagcatttagatgtgggcagcattcgagagctccctcacatcaatgcaccgaaa
gaatatcaaaaagaaacgaaggaaaaggaaacagatcgcaaaatcgtcgatgatgaagaa
gaaacaaaattcgaaaccactctggagcctgaggaggagcgtgattcgaaacgctcagcg
cccccatatgaagaagaggatgaagatgaagaaccagacttagcggaagaagctaaagtg
gaaatcatcattcttccaagtgaatctaaaccagctccatggttttctcaaactgtaaag
cgcaaggcataa

DBGET integrated database retrieval system