KEGG   Bacillus subtilis subsp. subtilis 168: BSU30900
Entry
BSU30900          CDS       T00010                                 

Gene name
cotS
Definition
(RefSeq) spore coat protein S
  KO
K06337  spore coat-associated protein S
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU30900 (cotS)
Other DBs
NCBI-GeneID: 936628
NCBI-ProteinID: NP_390968
Pasteur: BG11380
BSORF: BG11380
UniProt: P46914 A0A6M3ZIT5
Position
complement(3159691..3160746)
AA seq 351 aa
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLF
ITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSF
AGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHA
DKMLARGKEALRALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYD
LPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIG
HKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
NT seq 1056 nt   +upstreamnt  +downstreamnt
gtgtaccaaaaagagcatgaagaacagattgtgtccgaaattctcagttattatccgttt
catatcgaccatgtggcgctgaaatcgaacaaaagcgggcgcaaaatctgggaagtcgaa
actgatcatggcccaaagctgctaaaagaagcgcaaatgaaaccggagcggatgcttttt
atcactcaggcacacgcccatttacaagagaaagggctgccgatagcgccgattcatcaa
acaaaaaatggcggtagctgcttgggcacggatcaggtttcttacagtttatatgacaaa
gtgacaggaaaagaaatgatttactatgatgcagagcaaatgaaaaaagtcatgtcattt
gccggccattttcatcatgcctcaaaaggatatgtttgcacagatgaaagcaagaagaga
agcaggctgggaaaatggcacaaattgtaccgttggaagctgcaggaacttgaagggaat
atgcagatcgcagcatcctatcctgatgacgtattttcgcaaactttcttaaaacatgct
gataaaatgctggcaagaggaaaagaagctctcagagcgcttgatgactcagaatacgaa
acctggacaaaagagacactcgagcatggcggattctgttttcaggattttacattggca
cgtttgactgagatcgaaggggagccttttttaaaggagcttcactcgattacctacgat
ttgccgtcaagagaccttcgtattctgctgaataaagtgatggttaagctttctgtatgg
gatactgatttcatggttgcactgcttgcggcctacgacgcagtgtatccgctcacagaa
aaacagtacgaggtactttggattgatctcgcgtttccgcatttgttctgtgcaatcggg
cacaaatattatttgaagcaaaagaaaacgtggtcagatgagaagtataactgggcgctg
caaaacatgatttctgttgaagaatctaaagattcgtttttggataaactgccggaactg
tataaaaagataaaagcgtatcgggaggcgaattga

DBGET integrated database retrieval system