KEGG   Bacillus subtilis subsp. subtilis 168: BSU30910
Entry
BSU30910          CDS       T00010                                 

Symbol
cotSA
Name
(RefSeq) spore coat protein SA
  KO
K06338  spore coat protein SA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU30910 (cotSA)
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_1_2 Glyco_trans_4_2 Glyco_trans_4_4
Other DBs
NCBI-GeneID: 936379
NCBI-ProteinID: NP_390969
Pasteur: BG11381
BSORF: BG11381
UniProt: P46915 A0A6M4JKT8
Position
complement(3160761..3161894)
AA seq 377 aa
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYV
HLDEDRYEEAVGAELKKSRFDLVHVCNRPSWVPKLKKQAPDAVFILSVHNEMFAYDKISQ
AEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKTYHPRWTNEGQRARE
EMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNN
YVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLP
IITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAESNF
GWQRVAENLLSVYEKNR
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgaaaatagcactgatcgccacagagaagcttcctgtcccatcggttcgaggaggcgcc
attcaaatctacctcgaagcggttgcccctttaattgcaaaaaaacatgaggtgactgtg
ttttctattaaagatccgaatctcgctgatagagagaaggtagacggtgtccattatgtg
catttggatgaagaccgttatgaagaagccgttggagcagagctgaaaaagagccgtttt
gatcttgtgcatgtttgtaatcgcccaagctgggttccgaaattgaagaaacaggcgccg
gatgctgtttttattttaagcgttcacaatgaaatgttcgcttacgataaaatcagccag
gcggaaggcgagatttgcatcgactccgtagcgcagattgttacggtcagcgattatatc
ggacagacgatcacaagccgttttccgtcagcacgatcaaaaacaaaaacggtgtattct
ggtgtggatttaaaaacgtaccaccctcgctggacgaatgaagggcagcgagctcgcgaa
gagatgcgaagcgagctggggcttcacggcaaaaaaatcgtcttgtttgtcggccggctt
agcaaagtcaaaggcccgcacatattattgcaggctttgccggacatcattgaggagcac
cccgatgtcatgatggtgtttatcgggtcaaaatggttcggagataatgaattaaataac
tatgtcaaacatcttcatacccttggtgcgatgcaaaaggatcatgtcacatttattcaa
tttgtgaagccaaaggacattccgcgcctttataccatgtcagatgtatttgtatgctct
tcgcaatggcaggagcctttagcaagggtgcattatgaagcgatggctgcgggacttcct
attattacaagcaatcggggaggcaatccagaggtcatagaggaagggaaaaacggctac
atcattcatgactttgaaaatcctaaacaatatgccgaacgtatcaatgatttgctgagc
agctcggaaaagcgggaacggcttgggaaatacagccgccgtgaggcagaaagcaatttt
ggctggcagagggtggctgaaaatctgctcagcgtctatgaaaagaacagatag

DBGET integrated database retrieval system