KEGG   Bacillus subtilis subsp. subtilis 168: BSU30920
Entry
BSU30920          CDS       T00010                                 

Symbol
cotI
Name
(RefSeq) spore coat protein I
  KO
K06331  spore coat protein I
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU30920 (cotI)
SSDB
Motif
Pfam: APH Choline_kinase EcKL
Other DBs
NCBI-GeneID: 936682
NCBI-ProteinID: NP_390970
Pasteur: BG13821
BSORF: BG13821
UniProt: O34656 A0A6M4JLG6
Structure
PDB: 
2Q83

Position
3162084..3163157
AA seq 357 aa
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVW
KVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVV
YDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPIFTKLGRWPNHYTKRCKQM
ETWKLMAEAEKEDPFSQLYLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDY
GTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDDETFNVMLNAYESRA
PLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgtgtcctttaatggcagaaaaccatgaagtcattgaggaggggaattcatcagagctt
cctttatcagcagaagatgcaaaaaaattaacggagctggctgaaaatgtgcttcaagga
tgggatgtgcaggctgaaaaaatagacgtcattcagggaaaccagatggcgcttgtctgg
aaggtccacacagactccggcgcggtttgtctaaaacgaatacacaggccagaaaagaaa
gcgttgttttccattttcgcgcaggactatttagcaaaaaaaggcatgaatgttcctggc
atactcccaaacaaaaaaggcagcctatattctaagcacggctcatttctatttgtcgta
tatgactggatcgaaggaagaccgtttgagctgactgtaaagcaggacttggagtttatc
atgaaaggccttgctgattttcatacagcttccgtcggatatcagccgccaaatggcgtt
cccatatttaccaaattaggtcgctggccgaatcactacacgaaacgatgcaaacagatg
gaaacgtggaagctgatggcggaggcggaaaaagaagatcctttctcacagctttatctt
caggagatagatggctttattgaagacgggctgcgcatcaaagaccggcttttgcaatcg
acctatgttccatggactgaacagctgaaaaaaagccctaacctttgccaccaggattac
ggaaccgggaatacactcttaggagaaaatgaacagatttgggtcatcgacttagatacc
gtatcatttgatctgcctattcgcgatttgcgcaaaatgattattccgcttttggatacg
acgggtgtttgggatgacgaaacatttaatgtcatgctgaacgcatacgaatccagagcc
ccattaactgaagaacaaaaacaagtcatgtttattgatatgctgtttccttacgagctt
tacgatgtcattcgcgaaaaatacgtccgcaagtctgctttaccgaaggaagaattagaa
tcagcttttgaatatgaacgcattaaagcaaacgcattgcggcagcttatttaa

DBGET integrated database retrieval system