KEGG   Bacillus subtilis subsp. subtilis 168: BSU30930Help
Entry
BSU30930          CDS       T00010                                 

Gene name
ytaB
Definition
(RefSeq) hypothetical protein
  KO
K05770  translocator protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30930 (ytaB)
Transporters [BR:bsu02000]
 Other Transporters
  Others
   BSU30930 (ytaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TspO_MBR
Motif
Other DBs
NCBI-GeneID: 938164
NCBI-ProteinID: NP_390971
Pasteur: BG13822
BSORF: BG13822
UniProt: O34694
Position
3163237..3163704
Genome map
AA seq 155 aa AA seqDB search
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISL
SAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLI
IAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattgtcggcgctttagccgtttttgtgattacatatgcgctgttttcagcc
gcaggctacctgtttcctgtggaccaagaatggtacaattcattgaaaaaaccggactgg
acgccaagcggaactgcgatcggcatcatttgggccatcctgtttgccctgatctccctt
tcagcagccattgtatatgctgcgttttcatttaaaggtgcgaaaagcttttggtttaca
cttttgataaattacgtgctcaatcaagccttcagctatttccagtttacgcaaaaaaat
ctgctggctgcatcgcttgactgcctgcttgtcgccatcacagcaatcgtattactgatc
attgccaaaaaatacagcagagccgcaagctatcttcttttgccttattttttatggagt
gcatttgcgacgttcttatcctttacaatcaattcaatgaatctgtga

DBGET integrated database retrieval system