KEGG   Bacillus subtilis subsp. subtilis 168: BSU30940Help
Entry
BSU30940          CDS       T00010                                 

Gene name
glgP
Definition
(RefSeq) glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU30940 (glgP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     BSU30940 (glgP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3564
Motif
Other DBs
NCBI-GeneID: 936630
NCBI-ProteinID: NP_390972
Pasteur: BG10911
BSORF: BG10911
UniProt: P39123
Position
complement(3163735..3166131)
Genome map
AA seq 798 aa AA seqDB search
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIETNEKSRSNSG
KQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRL
AACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVD
VPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGG
NILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHK
KVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHL
FKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIENMAITAHGVVKMAHLAIVGSYSVNG
VAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQ
PESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPESIFDVQVKRLHAYK
RQLLNVLHIMYLYNRLKEDSGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDP
AVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDG
ANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGE
ADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSEHSIVNIAHSGYFSS
DRTIREYAKDIWGIKPMM
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgagtaaagaacgctttgcagacttatttttaaagcgtctggaaatgacgtgc
ggaaaaagctttaaagattctgccaagctggatcaatataaaacgttgggcaatatggtc
agagagtatatcagcgctgattggatcgaaacgaatgaaaaaagcagatcaaattccggg
aagcagacatattatttatcaatcgaatttctgctcggtcagctccttgagcaaaactta
atgaatcttggtgttcgtgatgttgtagaagctggtttaaaggaaatcggcatcaattta
gaggagatccttcagatagagaacgatgcaggtctcggcaatggcggacttgggcgcttg
gccgcttgctttttagattcgcttgcttcgttgaacctgcctgggcacggcatgggcata
cgttataagcatggtttgtttgagcaaaaaattgtagacggacatcaggtggagctgcct
gagcaatggctgaaaaacgggaacgtatgggaagtaaggaatgcggatcaagcagtggac
gtgccgttttggggcgaagtccatatgacagaaaaaagcgggcgcctgcattttcgccat
gaacaagcgacaattgttaccgctgttccttatgatatcccgatcatcggctatgaaacg
ggcactgtcaacacgttaaggctttggaacgccgagccctatgcccattatcacggcggt
aatattttgtcttataagcgagaaacagaagcggtttctgaattcttatatcccgatgac
acccatgatgaggggaaaattttacggctgaagcagcagtattttttagtatgcgcaagc
ttaaaaagcattgtgaacaattaccgtaaaacacataaatctttatccggcctgcataaa
aaagtgagcattcatattaatgacactcaccctgcgcttgcggtgcctgagctaatgcgg
attttgctcgatgaagagaacatgagctgggaagaagcttggcatatcactgtacatacg
atttcttatacaaatcatacaacattgtcagaagcgctcgagaaatggccgattcatttg
tttaagccgctgctcccgcgaatgtacatgattattgaagagatcaatgagaggttttgc
cgtgcagtttgggaaaagtatcctggagactggaaaaggatagagaacatggcgattaca
gcgcatggtgttgtcaaaatggctcatctggccatagtaggcagctacagtgtaaatggc
gttgcaaaaatacattccgatatattaaaggaaagggagatgcgcgactttcacttgctg
tttccgaatcgttttaacaataagacgaatggaattgcccacaggcgctggctgttaaaa
gcgaatccaggcttgtctgccatcattacagaggcgatcggcgatgaatgggtcaagcag
ccggaatcactgatccgtttagaaccgtacgccactgatcctgcatttattgaacagttt
caaaacaacaaaagcaagaaaaaacaagagcttgccgatttgattttttgcacggccggg
gtggttgtgaaccctgagagcatattcgacgtacaggtgaaacggcttcatgcatataaa
cggcagctgctgaatgttcttcacattatgtatttgtataaccgcctcaaggaggattcg
gggttttcaatctacccgcaaacctttattttcggggcaaaggcttcaccaagctattat
tatgccaagaaaatcattaagctgatccattctgtcgcagaaaaagtcaattatgatccg
gcggtcaaacagctgatcaaagttgtttttttagaaaattatagagtttctatggctgag
cgaatttttccggcatcagacgtaagtgagcaaatttcaaccgcaagcaaggaagcgtct
ggtacagggaatatgaagtttatgatgaacggggctttgacgatcggcacgcatgacggc
gcaaatatcgagatccttgagcgggtgggccctgactgtatttacacgttcggcttaaag
gcggatgaggttctatcgtatcaggaaaacggcggctataggtcgagggaatattatcag
catgacaggagaatcaggcaggtagcggatcagttgatcaatggtttttttgaaggagag
gcagatgaatttgaatcgatctttgactcgctgcttccgcataatgatgagtattttgtg
ctgaaggatttcagctcatatgcagatgcacaggagcgaattcaagctgattatcgagag
cgaaggaaatggtctgagcattcgattgtaaacattgctcattctggatatttctccagc
gaccgcacgatccgggaatatgcgaaggacatttggggcatcaagccgatgatgtga

DBGET integrated database retrieval system