KEGG   Bacillus subtilis subsp. subtilis 168: BSU30960
Entry
BSU30960          CDS       T00010                                 

Symbol
glgD
Name
(RefSeq) glycogen biosynthesis protein GlgD
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU30960 (glgD)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU30960 (glgD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     BSU30960 (glgD)
SSDB
Motif
Pfam: NTP_transferase Fucokinase
Other DBs
NCBI-GeneID: 936778
NCBI-ProteinID: NP_390974
Pasteur: BG10909
BSORF: BG10909
UniProt: P39124 A0A6M3ZFW3
Position
complement(3167569..3168600)
AA seq 343 aa
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPK
YRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQY
AVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGY
KTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTK
VKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGE
DCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
NT seq 1032 nt   +upstreamnt  +downstreamnt
gtgttcaataatcaaatgttaggtgttatagatgaaaccacatataagcattctcttcag
gatttaacagcacagcggtcgctcggggcgatcccttttgccggcaggtaccgactgatt
gattttatgctttccaacatggtgaatgcggatattaggagtgttgcaatttttccgaag
tatcgttaccgttcgctcatggatcaccttggggcgggtaaggaatgggatttgcaccgg
aaaaaggacggcctcttttttttcccgtctccccatcttcatcacgaatacgatgaattc
ggttcctttcgccagttttcggaccatctagattacttccacagaagcactcagcaatat
gctgtaatctccaacagccataccgtatgcaacattcaatttcaatatgtgctgaaacgc
catcaggaggttggctgcgacgtcaccgaggtatttcaggacggccagtcgctgcaaatc
tatatcatgtcaacaacgcttttaaaggatctgatctacggacatagcgaaaaaggctat
aaaaccattcaggaggctgttgaaaaggaatcttccgccctgaccatttgcccttatgaa
tattcaggttatgccgctgtcattgattcggtggaaaaatattatacccacagtatggag
ctcattcagcctcgtttttggcagcaggtgtttttgccgcagcagccgatctatacaaaa
gtgaaggatgagccgcctacgaaatacggaaagcacagcactgtcaaaaattctttggtg
gcaaacggctgtgtgcttgaaggagaggttgaaaactgcattttgttcagggcggtccat
gtcggaaagggtacgaagctgaaaaactgcattattatgcaaaaaacgcagattggagag
gattgtcttcttgagcaggtcatttcggataaggatgttaaaatcggcaaggcgacggaa
gctgcaggaacagctgagcagccgcttgtattaagaaaaggtttggtgcaaggagagctg
atgaattcttga

DBGET integrated database retrieval system