KEGG   Bacillus subtilis subsp. subtilis 168: BSU30970
Entry
BSU30970          CDS       T00010                                 

Symbol
glgC
Name
(RefSeq) glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU30970 (glgC)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU30970 (glgC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     BSU30970 (glgC)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Fucokinase DUF4954
Other DBs
NCBI-GeneID: 937990
NCBI-ProteinID: NP_390975
Pasteur: BG10908
BSORF: BG10908
UniProt: P39122 A0A6M4JN84
Position
complement(3168624..3169766)
AA seq 380 aa
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQY
QPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASSIYENLNYLNQYDPEY
VLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEK
PKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKG
YWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEG
CVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRS
EKDIEEVLLVSEEFVEKELI
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaaaaaacaatgtgtagccatgctccttgccggcgggaagggcagccgtctcagcgga
ttaacaaaaaatatggccaaaccggctgtatctttcgggggaaaatacaggattattgat
tttaccctaagcaactgttctaattcaggcatagacacagtcgggattttaacgcaatat
cagccgctcgagctgaattcctatattgggatcggcagtgcatgggacctggatagatat
aatggcggcgtgacggttttacccccttatgccgagtcatcagaagtcaaatggtataaa
gggacggcaagctccatttatgaaaatctcaattatttgaatcagtatgatcctgagtat
gtactgattttatcaggagatcacatatacaaaatggactacggcaaaatgcttgattat
cacattgaaaagaaagcagatgtgaccatctctgtcatcgaagtgggctgggaggaagca
agccggttcggcatcatgaaggccaatccagatgggacgatcacacattttgatgaaaag
cccaaattccctaagagcaatcttgcctcaatgggaatttatatattcaattggccgctt
ttgaaacagtatcttgagatggacgatcaaaacccttattctagccacgacttcggcaaa
gacattattccactgcttttggaagagaaaaagaagctttctgcttatccgttcaaggga
tattggaaggatgtcggaacggtgcagagcttgtgggaagccaatatggatttgttaaaa
gaggactcggagctgaagctgtttgaacgcaaatggaaaatttactccgtcaatccaaat
cagcctccgcaatttatttcatctgatgcgcaggttcaagattcgcttgtgaacgaaggt
tgtgttgtatatggaaatgtgtctcactccgttctttttcaaggtgtgactgttggtaag
catacgactgttacatcatccgtcataatgccggatgtgacgattggggagcatgtagtc
attgaaaatgccatcgttcctaatgggatggtgctgccggatggcgcagtgattcgctcc
gaaaaagacattgaagaggtgctgctcgtttcagaggaatttgtagaaaaagaattgatt
taa

DBGET integrated database retrieval system