KEGG   Bacillus subtilis subsp. subtilis 168: BSU30990
Entry
BSU30990          CDS       T00010                                 

Symbol
thiT
Name
(RefSeq) thiamine transporter ThiT
  KO
K16789  thiamine transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30990 (thiT)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU30990 (thiT)
SSDB
Motif
Pfam: Thia_YuaJ ECF_trnsprt
Other DBs
NCBI-GeneID: 937137
NCBI-ProteinID: NP_390977
Pasteur: BG13949
BSORF: BG13949
UniProt: O32074 A0A6M4JNZ3
Position
3179306..3179884
AA seq 192 aa
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLT
TGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSV
VSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLF
MTAPRLLKSDKA
NT seq 579 nt   +upstreamnt  +downstreamnt
atgaatcaatctaagcaactggttcgccttattgaaattgccattatgacagcggcagcc
gttattttagacattgtctcaggaatgtttcttagcatgcctcaaggaggctcggtctcc
atcatgatgattccgatctttttaatttcgtttcgctggggtgtcaaagcaggtcttact
acaggtttgttgacaggtctagtacaaatagcaatcggaaacttgtttgctcaacatcct
gtacagctattgttagattacattgtcgctttcgcagcaatcggcataagcggctgtttc
gcttcttctgtccgtaaagccgctgtatcaaaaacaaaagggaaattgattgtttcagtg
gtcagcgcagtttttatcggcagtttgctgcgctatgccgcgcatgtcatttcaggagct
gtgtttttcggcagctttgctccaaaaggaacaccggtatggatttattctttaacttat
aatgcgacttacatggttccttcattcattatttgtgcaattgtcctatgtttattattt
atgacagcaccccgtctgcttaaaagtgacaaagcgtaa

DBGET integrated database retrieval system