KEGG   Bacillus subtilis subsp. subtilis 168: BSU31000Help
Entry
BSU31000          CDS       T00010                                 

Gene name
yuaI
Definition
(RefSeq) N-acetyltransferase YuaI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 FR47 Acetyltransf_7 Acetyltransf_10 Acetyltransf_4
Motif
Other DBs
NCBI-GeneID: 938830
NCBI-ProteinID: NP_390978
Pasteur: BG13948
BSORF: BG13948
UniProt: O32075
Position
complement(3179926..3180447)
Genome map
AA seq 173 aa AA seqDB search
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQ
DEKGSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEFLLQHGFSSM
FVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggtaactgtacgtgaagcgaagttagaggatataaaggacattgcaaaagtgcatgta
gacagctggaggacaacataccacgaaattatcccgattgattatttaaacagcctgaac
tataaggaatttgaagacaaatggaaaagtcgctcgttaaagggagtatttgttgctcag
gacgaaaagggttcagtattcggctttgcttcatttggacctattcgctctgaacaagaa
ggctatgacggcgagttatacgctatttatcttctggaagagcgccagcggcaaggtgca
ggcagggcgctcttagcaaaaggagcggagtttttgcttcaacatggtttttcaagtatg
tttgtttgggttattgagcagaatccctcgattatattttatcaggcctattcacctgaa
agagtagcggaggacaactttgaaattgccggagtaaggctgaaagaagtaggtcttggc
tggccggatctttcagctttaaaaacacttcttaacagataa

DBGET integrated database retrieval system