KEGG   Bacillus subtilis subsp. subtilis 168: BSU31010Help
Entry
BSU31010          CDS       T00010                                 

Gene name
yuaG
Definition
(RefSeq) hypothetical protein
  KO
K07192  flotillin
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bsu04131]
    BSU31010 (yuaG)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU31010 (yuaG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU31010 (yuaG)
Membrane trafficking [BR:bsu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    BSU31010 (yuaG)
Chromosome and associated proteins [BR:bsu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    BSU31010 (yuaG)
Exosome [BR:bsu04147]
 Exosomal proteins
  Proteins found in most exosomes
   BSU31010 (yuaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Band_7 Flot DUF1326
Motif
Other DBs
NCBI-GeneID: 937138
NCBI-ProteinID: NP_390979
Pasteur: BG13947
BSORF: BG13947
UniProt: O32076
Position
complement(3180465..3181994)
Genome map
AA seq 509 aa AA seqDB search
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIV
RGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAA
EQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLV
IVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELER
ATEIAEAEKINQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQI
ELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAE
KVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPE
YAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLE
NFSGKGNVKQSINELTNEIKEAKTIQKSE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgccgattataatgatcatcggagttgtattctttttattaattgcactaata
gctgtgtttattacgaagtatcgtacagcagggcctgatgaagcgttaattgtaacaggg
agctatctgggtaataaaaatgttcatgtcgatgaaggcggcaaccgtattaaaatcgtc
cgcggcggaggaacctttgtccttcccgtcttccagcaggcagagccgctaagcctatta
tcaagcaaactcgatgtttcgacacctgaagtctatacagaacaaggagtgccagtaatg
gccgatggaactgcgattattaaaatcggcggttctataggagaaatcgctacagcggcc
gaacaatttttagggaaatcaaaagacgaccgtgagcaggaagcgcgggaggttttagaa
ggccaccttcgttccattctcggctcaatgacagtagaagaaatctataaaaacagagaa
aaattctctcaagaggtgcagcgtgtcgcttcacaggatctcgcgaaaatgggacttgta
atcgtctcgtttaccattaaagatgttcgtgataaaaacggttatcttgaatcattaggg
aaaccgagaattgcccaagtaaaacgcgatgctgatatcgcaacagcagaggctgataaa
gaaacccgaattaagcgggcagaagccgataaagacgcaaaaaaatcagaacttgaacgg
gcgacggaaatcgctgaagctgaaaaaatcaatcagctcaaaatggctgaattccgcaga
gaacaagatacggcaaaagcgaatgccgaccaagcatatgatttagagactgcccgagcg
cgccagcaagtcacagagcaggaaatgcaggttaaaattatcgaacgccaaaaacaaata
gaactagaagaaaaagaaattcttcgccgtgaacgtcaatacgactcagaggtaaagaaa
aaagccgatgcagaccgttattctgttgagcagtccgcagcagctgagaaagccaaacag
ctcgcggaagccgatgccaagaagtacagtattgaagcaatggcaaaggctgaggcggaa
aaagtaagaattgacgggctagcaaaagcagaagcggaaaaagcgaaaggagagacagaa
gcagaggttatccgcctgaaaggtcttgcagaagcggaagcaaaagagaaaattgcggcc
gcctttgaacagtacgggcaggcggcgattttcgatatgattgtcaaaatgcttccggaa
tacgcgaaacaagcagcggcacctctttcaaatattgataaaatcaccgttgtcgataca
ggaggaagcggtgaatcaagcggagcaaacaaagtaaccagctatgcgacgaacttaatg
tcaagtctgcaagaaagtttaaaagcatcctcaggaattgatgtaaaagaaatgcttgag
aacttttcaggaaaaggaaacgtaaaacaaagcattaatgaattaacaaatgaaatcaaa
gaagccaaaacgatccaaaaatcagagtaa

DBGET integrated database retrieval system