KEGG   Bacillus subtilis subsp. subtilis 168: BSU31020Help
Entry
BSU31020          CDS       T00010                                 

Gene name
yuaF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NfeD
Motif
Other DBs
NCBI-GeneID: 937144
NCBI-ProteinID: NP_390980
Pasteur: BG13946
BSORF: BG13946
UniProt: O32077
Structure
PDB: 

Position
complement(3182015..3182539)
Genome map
AA seq 174 aa AA seqDB search
MELFGVPIQTMYLYTLIIAGSLTLLFLFFGDVFSGLSEGIPFLNPTLVLSFFTCFSAGGY
IGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITA
VPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
ttggagttatttggagtacctatacaaacaatgtatctttatacgcttattattgcgggc
agccttacgctgttattcctgtttttcggagatgtattttcagggctgtcagaaggcatt
ccgtttcttaatccgacattagtgctctcattttttacatgtttttcagcgggcggatat
ataggtgaacttgtattgcctctgtcaagcttgctgattgcgcttttatcttgcatcctt
tcgatcatgctggtggtattgcttcacatctttgtactggtgccattatcatctgcagaa
gaatcattggcatatagagaagatgatctcagaggaagactcggtaaagtgattacagct
gtgccggttgacgggtttggtgaagtggtcatagaagggataggcgggaccatttcaaag
tcagcggtcagttttgataatcagcagatcagttacgggacaacggtgttagtcgtagat
attaacaacggagttctttcggttactccgcatgaacccatttaa

DBGET integrated database retrieval system