KEGG   Bacillus subtilis subsp. subtilis 168: BSU31020
Entry
BSU31020          CDS       T00010                                 

Gene name
yuaF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NfeD
Other DBs
NCBI-GeneID: 937144
NCBI-ProteinID: NP_390980
Pasteur: BG13946
BSORF: BG13946
UniProt: O32077 A0A6M4JLH5
Structure
PDB: 
2K14

Position
complement(3182015..3182539)
AA seq 174 aa
MELFGVPIQTMYLYTLIIAGSLTLLFLFFGDVFSGLSEGIPFLNPTLVLSFFTCFSAGGY
IGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITA
VPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
NT seq 525 nt   +upstreamnt  +downstreamnt
ttggagttatttggagtacctatacaaacaatgtatctttatacgcttattattgcgggc
agccttacgctgttattcctgtttttcggagatgtattttcagggctgtcagaaggcatt
ccgtttcttaatccgacattagtgctctcattttttacatgtttttcagcgggcggatat
ataggtgaacttgtattgcctctgtcaagcttgctgattgcgcttttatcttgcatcctt
tcgatcatgctggtggtattgcttcacatctttgtactggtgccattatcatctgcagaa
gaatcattggcatatagagaagatgatctcagaggaagactcggtaaagtgattacagct
gtgccggttgacgggtttggtgaagtggtcatagaagggataggcgggaccatttcaaag
tcagcggtcagttttgataatcagcagatcagttacgggacaacggtgttagtcgtagat
attaacaacggagttctttcggttactccgcatgaacccatttaa

DBGET integrated database retrieval system