KEGG   Bacillus subtilis subsp. subtilis 168: BSU31030
Entry
BSU31030          CDS       T00010                                 

Symbol
yuaE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DinB_2 DinB DUF1569 MDMPI_N DUF664 DUF6197 SecA_SW
Other DBs
NCBI-GeneID: 937143
NCBI-ProteinID: NP_390981
Pasteur: BG13945
BSORF: BG13945
UniProt: O32078 A0A6M4JMI3
Position
3182707..3183195
AA seq 162 aa
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAP
IKEIEEKPLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDF
ERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagtatctttaatgaagccagattagaaacgtggaacgaattgaaaggactttctgac
gaaaagctgaatcaaaagccttctgctgaagaatggagcatacgggaagttcttgaccat
ttgaaaaaaatcgatatgaccgcacaaaaaatgttgaaggaacgtgtaaaggacgctccg
attaaagaaattgaagaaaaaccgcttgaagtagcacaggacagaaataataaacggaaa
gccccgagtcatcttgagcctgcgcatgattttatttcaggcagccaaatgaaacgtgag
cttgatgtggtaagagagcagctgactgctgcgattgcctctctgaaagaagaagatttt
gaaagagtgcttccgcatcctgtgtttcaagagctgactgtcagacagtggatcgatttt
atcggccatcatgaaaaacggcacctcagccaaatgaaagaaattaaagaaaagatagaa
agggcctga

DBGET integrated database retrieval system