KEGG   Bacillus subtilis subsp. subtilis 168: BSU31030Help
Entry
BSU31030          CDS       T00010                                 

Gene name
yuaE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DinB_2 DUF1569 MDMPI_N DinB DUF664
Motif
Other DBs
NCBI-GeneID: 937143
NCBI-ProteinID: NP_390981
Pasteur: BG13945
BSORF: BG13945
UniProt: O32078
Position
3182707..3183195
Genome map
AA seq 162 aa AA seqDB search
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAP
IKEIEEKPLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDF
ERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagtatctttaatgaagccagattagaaacgtggaacgaattgaaaggactttctgac
gaaaagctgaatcaaaagccttctgctgaagaatggagcatacgggaagttcttgaccat
ttgaaaaaaatcgatatgaccgcacaaaaaatgttgaaggaacgtgtaaaggacgctccg
attaaagaaattgaagaaaaaccgcttgaagtagcacaggacagaaataataaacggaaa
gccccgagtcatcttgagcctgcgcatgattttatttcaggcagccaaatgaaacgtgag
cttgatgtggtaagagagcagctgactgctgcgattgcctctctgaaagaagaagatttt
gaaagagtgcttccgcatcctgtgtttcaagagctgactgtcagacagtggatcgatttt
atcggccatcatgaaaaacggcacctcagccaaatgaaagaaattaaagaaaagatagaa
agggcctga

DBGET integrated database retrieval system