KEGG   Bacillus subtilis subsp. subtilis 168: BSU31040Help
Entry
BSU31040          CDS       T00010                                 

Gene name
yuaD
Definition
(RefSeq) metal-sulfur cluster biosynthesis proteins YuaD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MOSC
Motif
Other DBs
NCBI-GeneID: 937141
NCBI-ProteinID: NP_390982
Pasteur: BG13944
BSORF: BG13944
UniProt: O32079
Structure
PDB: 

Position
complement(3183201..3183779)
Genome map
AA seq 192 aa AA seqDB search
MWKRMTAKAEGLYIADTKSFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEI
FNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAAL
LCEGENDPCIQPGEVIQSYYPDQPKLASAFVRHALGIRGIVCIVERPGAVYTGDEIEVHS
YQRKVKRKAERV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagcgtatgactgcaaaagcggaaggcttatatatcgcagatacaaaaagcttc
gtaacaaagcaaatggacaagcttgattttgattatggcggcatccccggcgacttgcat
tttggcctgaccaaaaaagcgggagccagagaaccaatgttttcaagagggactgaaatt
ttcaaccgcagacaaatttcaattgtttcaatagaggaatgcaacgaaatcgctttaaaa
atgggagtgccgagaattttgccggaatggctcggggcgaatgtggcagtcagcggtatg
ccagatcttacttcattaaaagaaggaagccggattatttttccgagcggagcggctctg
ctgtgtgagggcgaaaatgatccgtgtatccagccgggagaagtcattcagtcttattat
ccggaccaaccgaagctggcgtcggctttcgtccgccacgcactgggcattagagggatt
gtctgtattgtggagagacctggtgctgtttacacaggtgatgaaatagaagttcattcc
tatcagcgaaaagtcaaacgaaaagcagaaagggtctga

DBGET integrated database retrieval system