KEGG   Bacillus subtilis subsp. subtilis 168: BSU31040
Entry
BSU31040          CDS       T00010                                 

Symbol
yuaD
Name
(RefSeq) metal-sulfur cluster biosynthesis proteins YuaD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MOSC
Other DBs
NCBI-GeneID: 937141
NCBI-ProteinID: NP_390982
Pasteur: BG13944
BSORF: BG13944
UniProt: O32079 A0A6M4JMX2
Structure
PDB: 
1ORU

Position
complement(3183201..3183779)
AA seq 192 aa
MWKRMTAKAEGLYIADTKSFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEI
FNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAAL
LCEGENDPCIQPGEVIQSYYPDQPKLASAFVRHALGIRGIVCIVERPGAVYTGDEIEVHS
YQRKVKRKAERV
NT seq 579 nt   +upstreamnt  +downstreamnt
atgtggaagcgtatgactgcaaaagcggaaggcttatatatcgcagatacaaaaagcttc
gtaacaaagcaaatggacaagcttgattttgattatggcggcatccccggcgacttgcat
tttggcctgaccaaaaaagcgggagccagagaaccaatgttttcaagagggactgaaatt
ttcaaccgcagacaaatttcaattgtttcaatagaggaatgcaacgaaatcgctttaaaa
atgggagtgccgagaattttgccggaatggctcggggcgaatgtggcagtcagcggtatg
ccagatcttacttcattaaaagaaggaagccggattatttttccgagcggagcggctctg
ctgtgtgagggcgaaaatgatccgtgtatccagccgggagaagtcattcagtcttattat
ccggaccaaccgaagctggcgtcggctttcgtccgccacgcactgggcattagagggatt
gtctgtattgtggagagacctggtgctgtttacacaggtgatgaaatagaagttcattcc
tatcagcgaaaagtcaaacgaaaagcagaaagggtctga

DBGET integrated database retrieval system