KEGG   Bacillus subtilis subsp. subtilis 168: BSU31050Help
Entry
BSU31050          CDS       T00010                                 

Gene name
gbsB
Definition
(RefSeq) alcohol dehydrogenase
  KO
K11440  choline dehydrogenase [EC:1.1.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU31050 (gbsB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BSU31050 (gbsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Hydrolase
Motif
Other DBs
NCBI-GeneID: 938832
NCBI-ProteinID: NP_390983
Pasteur: BG11941
BSORF: BG11941
UniProt: P71017
Position
complement(3183867..3185075)
Genome map
AA seq 402 aa AA seqDB search
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADP
VIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVE
ATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPL
IAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYI
KRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGP
VMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPD
MIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacattaaatatgaaggtagaaagcatgcagaaattccacacatttgaaattccgact
gtgattaagcatggaatcggagccatcaagcatacgggtgaggaagtagctgcactgggc
gtttcaaaagcgctccttgtcacagaccctgggatttataaagccggtgttgctgatccc
gtaatcgaatcacttaaagaagcaggcattgaagtggtactctttaataaagttgagcca
aacccgcctgtccgtctggtgaatgaaggatctgagctttacaaaaaagagaactgtaat
ggtttggtggcagtcggaggcggaagctccatggatacagcaaaagcaatcggagtagaa
gcgactcacgaaggaagcgtgcttgattatgaagcggcagatgggaaaaaaccgctggaa
aaccgcattcctccgctgacgacaattcccactacagctggaaccggatcagaagtaacc
caatgggcggttatcacagatgaagaaagagaattcaaattcaacacgggcggtccgctg
attgcagcgcacttgacaatcattgatcctgagcttcatgtttcaatgcctccgcatgta
acagctatgacgggaattgatgcgctcgcccatgccattgagtgctatacaatgaaattt
gcacagccaatcacggatgcggttgccttaatggcgattgagtatgccgctcattacatc
aagagggcatttgctgatggagaggatctggaagcaaggtacggaatggcgcaggctgcg
atgcttgccggtctttcttacggaagtgaatcagcgggcgctgctcatgcgatgagccaa
acgcttggcggtattatcccagtcgctcacggccaatgtgtagcggcgatgatgggccct
gtcatggaatacaactggaagggctatcctgagaagtttgcgcgtattgcgaaagcgttc
ggtattgatacaagcaagatgacaacagaagaagctgcgaaagcatctgtcaattggatg
tatgatctggtcgaagatttagaagtgccgactttagaagagcagggagtatcacctgat
atgatcgaacgcttgtctaaagaagcaatgaaagatccgcaaaccttcggaaaccctaga
gatttaaatgaaaaagcatacaactggatctacaaacgctgctttaaccttacgcctaaa
acggtataa

DBGET integrated database retrieval system