KEGG   Bacillus subtilis subsp. subtilis 168: BSU31060Help
Entry
BSU31060          CDS       T00010                                 

Gene name
gbsA
Definition
(RefSeq) betaine aldehyde dehydrogenase
  KO
K00130  betaine-aldehyde dehydrogenase [EC:1.2.1.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU31060 (gbsA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.8  betaine-aldehyde dehydrogenase
     BSU31060 (gbsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 938829
NCBI-ProteinID: NP_390984
Pasteur: BG11940
BSORF: BG11940
UniProt: P71016
Position
complement(3185092..3186564)
Genome map
AA seq 490 aa AA seqDB search
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSS
LSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKD
GGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITP
LTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAAS
GNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFL
AELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPEL
QNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKD
IEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNT
KPAAVNWFNS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaacattattcattgacggagaatggatcagtgccgaaaaagaacagatccgc
agtattatcaacccatttaatcaagaagaaattgcaactgtaagcgagggagggcgagag
gacgccatcaaagcaatcgcagccgcacgtagagcatttgacaaaggagaatggtcatcg
ctatccgggcttgaacgcggaaaaattgttctgaaaattgcggaattaatcagacgcgat
cttgaggagctggctgagcttgaatctcttgatacaggaaaaacactcgaagaaagcaag
gccgatatggacgatatcgccaatgtttttcaatattacgccggcttggcagacaaagat
ggcggagagatcatttcatctccgattcctgattcagaaagcaaaattattagggagcca
atcggggtttgcggccagatcactccatggaattatccgctccttcaagcgagctggaaa
atcgcccctgcactggccgcaggaaacacaatcgtcatgaagccgagtgagattacgccg
ctgacgacaatcaaagtctttaagctgatggaagaagccggtgttccaaaaggtgtcgca
aatcttgttcttggaccgggagccacagtgggcgacgagcttgccgtaaacaaagacgtc
gatttgatttcatttacgggcggaattgaaacaggcaaaaaaatcatgcgggcggcaagc
ggaaacgtcaaaaaaatcgcccttgaacttggcgggaaaaacccaaatattgttttcaag
gacgcggatttagaagttgcggttgatcaggccttaaacgctgtatttttccacgccggc
caagtatgctctgcaggttcccgcttgcttgttgaggatgccattcatgatcaatttttg
gcggagctggtcaaacgggcaaaacgcataaaactcggaaacggttttcatgctgagaca
gaaagcggtccgcttatttcggcggagcacagggcaaaggtagaaaaatatgtagagatc
ggaatagaggaaggcgcgaagctggagacaggaggcaaacgcccggaagatcctgagctt
caaaacggctttttctatgaacctactattttctcaaactgtaattctgacatgagaatc
gttcaggaagaggttttcggtcctgtattgacagtcgaaaccttcagctctgaagaagag
gtaatcgagcttgcgaatgataccatctatggcttggctggagcggtatggtcaaaagac
attgaaaagtgcgaacgggtagcagcccgcttgagaatgggaaccgtttggatcaacgat
tttcatccgtactttgcacaagcgccatggggcggatataagcaatccgggttcggacgc
gagcttggaaaaataggccttgaagaatacacagaagtcaaacatgtataccgcaataca
aaaccggcagcggttaactggtttaattcataa

DBGET integrated database retrieval system