KEGG   Bacillus subtilis subsp. subtilis 168: BSU31070Help
Entry
BSU31070          CDS       T00010                                 

Gene name
yuaC
Definition
(RefSeq) hypothetical protein
  KO
K22109  HTH-type transcriptional regulator, glycine betaine synthesis regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU31070 (yuaC)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    BSU31070 (yuaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR_2 Glyco_transf_28 EMP24_GP25L HTH_34 Rapsyn_N MarR HTH_20 Lyase_aromatic
Motif
Other DBs
NCBI-GeneID: 938843
NCBI-ProteinID: NP_390985
Pasteur: BG12342
BSORF: BG12342
UniProt: P71015
Position
3186763..3187305
Genome map
AA seq 180 aa AA seqDB search
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSK
PSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVTAIEE
AQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPVETK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaatccagaatttgcagctatagaacaggctcgggatcttgttattgactcc
attgctgaaacgatggatctttacggaattacccgcagtgtcgggattttatatgggacg
atgtatatgagggatgagatgacgcttgacgaaatgcgtgaggagttgcaaatgagcaaa
ccaagcatgagcactggcgtcaaaaagcttcaagacttaaatgtagtgaaaaaaacattt
caccggggcatccgcaagcatacatttgtggctgagaaggatttctttaaatttttcaca
aatttctttccacctaaatgggagcgggaggttcaagtgaatgtaacagcgatcgaggaa
gctcaagctgatttacaaaaggttttatgcaaggaagatctcgatgaggatatcaaaaat
gaagcactgcagttatatgatcagctggaaagctctaaagcttactatgactggctgaaa
cggcttgctgaatcggtgcagaccggagaaatttttaaatttataccggtcgaaacaaag
taa

DBGET integrated database retrieval system