KEGG   Bacillus subtilis subsp. subtilis 168: BSU31090Help
Entry
BSU31090          CDS       T00010                                 

Gene name
ktrA
Definition
(RefSeq) ktr system potassium uptake protein A
  KO
K03499  trk system potassium uptake protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31090 (ktrA)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU31090 (ktrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_N TrkA_C NAD_binding_2 UDPG_MGDP_dh_N 2-Hacid_dh_C F420_oxidored ADH_zinc_N 3HCDH_N CoA_binding_2 AlaDh_PNT_C Shikimate_DH UPF0146 ApbA adh_short NAD_binding_10 NAD_Gly3P_dh_N ThiF Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 937145
NCBI-ProteinID: NP_390987
Pasteur: BG13943
BSORF: BG13943
UniProt: O32080
Structure
PDB: 

Position
3188414..3189082
Genome map
AA seq 222 aa AA seqDB search
MGRIKNKQFAVIGLGRFGGSICKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEE
NELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADR
IIHPEKDMGVKIAQSLSDENVLNYIDLSDEYSIVELLATRKLDSKSIIDLNVRAKYGCTI
LAIKHHGDICLSPAPEDIIREQDCLVIMGHKKDIKRFENEGM
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgggaagaattaaaaataagcaatttgccgtgatcgggctgggccggtttggcggcagc
atttgtaaagaacttcatagaatggggcatgaggtccttgcggttgatatcaacgaagaa
aaggtcaatgcatatgcttcttacgccactcatgcggtaattgccaacgccaccgaagaa
aacgaattgctttcattaggaatacgcaattttgaatatgtgattgttgccatcggagca
aatattcaagcgagtacgctgaccaccctattattaaaggagcttgatattccaaatatt
tgggtgaaggctcaaaactattatcatcacaaggtgcttgaaaaaataggcgctgaccgc
attattcatcctgaaaaagatatgggggttaaaatcgcacaaagcctttcagacgaaaat
gttttgaattacattgatctatctgatgaatacagtattgtcgagctgctggctacgcgc
aagcttgattcaaaatcgattattgacctgaatgtaagagcaaagtacggctgcacgatc
ctggccattaaacatcatggagatatctgtctttcccccgcgcctgaagacatcattcgc
gagcaagattgcctggtgatcatgggccacaaaaaggatattaaacgttttgaaaacgaa
gggatgtag

DBGET integrated database retrieval system