KEGG   Bacillus subtilis subsp. subtilis 168: BSU31090
Entry
BSU31090          CDS       T00010                                 

Gene name
ktrA
Definition
(RefSeq) ktr system potassium uptake protein A
  KO
K03499  trk/ktr system potassium uptake protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31090 (ktrA)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU31090 (ktrA)
SSDB
Motif
Pfam: TrkA_N TrkA_C NAD_binding_2 UDPG_MGDP_dh_N F420_oxidored 2-Hacid_dh_C ADH_zinc_N 3HCDH_N CoA_binding_2 Shikimate_DH AlaDh_PNT_C UPF0146 ApbA adh_short NAD_binding_10 NAD_Gly3P_dh_N Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 937145
NCBI-ProteinID: NP_390987
Pasteur: BG13943
BSORF: BG13943
UniProt: O32080 A0A6M4JLB4
Structure
PDB: 

Position
3188414..3189082
AA seq 222 aa
MGRIKNKQFAVIGLGRFGGSICKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEE
NELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADR
IIHPEKDMGVKIAQSLSDENVLNYIDLSDEYSIVELLATRKLDSKSIIDLNVRAKYGCTI
LAIKHHGDICLSPAPEDIIREQDCLVIMGHKKDIKRFENEGM
NT seq 669 nt   +upstreamnt  +downstreamnt
ttgggaagaattaaaaataagcaatttgccgtgatcgggctgggccggtttggcggcagc
atttgtaaagaacttcatagaatggggcatgaggtccttgcggttgatatcaacgaagaa
aaggtcaatgcatatgcttcttacgccactcatgcggtaattgccaacgccaccgaagaa
aacgaattgctttcattaggaatacgcaattttgaatatgtgattgttgccatcggagca
aatattcaagcgagtacgctgaccaccctattattaaaggagcttgatattccaaatatt
tgggtgaaggctcaaaactattatcatcacaaggtgcttgaaaaaataggcgctgaccgc
attattcatcctgaaaaagatatgggggttaaaatcgcacaaagcctttcagacgaaaat
gttttgaattacattgatctatctgatgaatacagtattgtcgagctgctggctacgcgc
aagcttgattcaaaatcgattattgacctgaatgtaagagcaaagtacggctgcacgatc
ctggccattaaacatcatggagatatctgtctttcccccgcgcctgaagacatcattcgc
gagcaagattgcctggtgatcatgggccacaaaaaggatattaaacgttttgaaaacgaa
gggatgtag

DBGET integrated database retrieval system