KEGG   Bacillus subtilis subsp. subtilis 168: BSU31100Help
Entry
BSU31100          CDS       T00010                                 

Gene name
ktrB
Definition
(RefSeq) ktr system potassium uptake protein B
  KO
K03498  trk system potassium uptake protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31100 (ktrB)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU31100 (ktrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkH
Motif
Other DBs
NCBI-GeneID: 938835
NCBI-ProteinID: NP_390988
Pasteur: BG13956
BSORF: BG13956
UniProt: O32081
Structure
PDB: 

Position
3189089..3190426
Genome map
AA seq 445 aa AA seqDB search
MTLQKDKVIKWVRFTPPQVLAIGFFLTIIIGAVLLMLPISTTKPLSWIDALFTAASATTV
TGLAVVDTGTQFTVFGQTVIMGLIQIGGLGFMTFAVLIVMILGKKIGLKERMLVQEALNQ
PTIGGVIGLVKVLFLFSISIELIAALILSIRLVPQYGWSSGLFASLFHAISAFNNAGFSL
WPDNLMSYVGDPTVNLVITFLFITGGIGFTVLFDVMKNRRFKTFSLHTKLMLTGTLMLNA
IAMLTVFILEYSNPGTLGHLHIVDKLWASYFQAVTPRTAGFNSLDFGSMREGTIVFTLLL
MFIGAGSASTASGIKLTTFIVILTSVIAYLRGKKETVIFRRSIKYPIIIKALAVSVTSLF
IVFLGIFALTITEQAPFLQIVFETFSAFGTVGLTMGLTPELTTAGKCIIIVIMFIGRIGP
LTFVFSFAKTEQSNIRYPDGEVFTG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgacacttcaaaaggataaagtgatcaaatgggttcggtttacaccgcctcaagtgctt
gccattggttttttccttaccattatcatcggggctgtcctattaatgcttccgatttcc
actacgaagccattgtcatggatagatgccctttttactgcggcttccgctacaactgtt
acagggcttgctgttgtcgataccggcactcaatttacggtattcgggcaaacagtaatt
atggggctgattcagattggcgggcttggatttatgacatttgcggtcttgatcgtcatg
atattaggaaaaaaaatcggcttaaaagaacgaatgctcgtccaggaagccttaaaccag
ccgacaatcggcggtgtcattggccttgtcaaagtcctgtttctgttttcgatcagtatt
gaattgatagcagcactcattttatccatccggcttgtacctcaatacggctggtcatcc
ggcttgtttgcaagtttgtttcacgcaatatctgcttttaacaatgccgggttttcgttg
tggcctgataatttgatgagctacgttggcgatcctacagtgaacctcgtgattactttc
ttatttattacaggagggatcggatttacggttctgtttgatgtgatgaaaaatcggcgt
tttaaaactttttctttacatacaaagctcatgcttacaggaacgctgatgttgaatgcg
atcgctatgcttacggtctttattttagaatacagcaaccccggcacgctcggccacctg
catatagtggataaactgtgggcctcctattttcaggcagtgacgccgagaaccgcaggg
ttcaattctctagattttggaagcatgagagaaggaacaattgtatttactttattattg
atgtttatcggagcaggaagcgcatcaacggcgagcggcattaagctgactacgttcatc
gtgattttaacatctgttattgcttacttgagaggtaaaaaagaaacggttattttccgc
cgttccatcaaatatccgattatcattaaagctttagctgtgagcgtcaccagtttgttc
atcgtgtttttagggattttcgccctgacgatcacagaacaagcgccatttcttcaaatt
gtgtttgaaaccttttccgcattcggaactgtcggccttacgatggggcttactcctgaa
ctgacaacagctggcaagtgtatcatcattgtcatcatgtttatcggaagaattggtcct
ttaacgttcgtgttttcattcgcaaaaacagagcaatcaaatatccgttatcctgatggc
gaagtgtttacagggtga

DBGET integrated database retrieval system