KEGG   Bacillus subtilis subsp. subtilis 168: BSU31110
Entry
BSU31110          CDS       T00010                                 

Symbol
yubF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YiaAB DUF6077 YaeQ DUF2157
Other DBs
NCBI-GeneID: 937150
NCBI-ProteinID: NP_390989
Pasteur: BG13955
BSORF: BG13955
UniProt: O32082 A0A6M3ZFN2
Position
complement(3190462..3190725)
AA seq 87 aa
MQKYRRRNTVAFTVLAYFTFFAGVFLFSIGLYNADNLELNEKGYYIAVMILVAVGAILTQ
KVTRDNAEDNEIIAEQEKRQNQSHIES
NT seq 264 nt   +upstreamnt  +downstreamnt
gtgcagaaatatagacgcagaaacacggttgcctttacagtactagcttattttactttt
tttgcgggagtatttttgtttagtatcggactctataatgctgataatctggaactcaat
gaaaaaggttattacatcgctgttatgatacttgtagcagttggtgcgattcttacgcaa
aaagtgacccgtgataacgcggaggataacgaaatcatcgcggaacaggaaaaaagacaa
aatcaatctcatatcgaatcataa

DBGET integrated database retrieval system