KEGG   Bacillus subtilis subsp. subtilis 168: BSU31110Help
Entry
BSU31110          CDS       T00010                                 

Gene name
yubF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YiaAB DUF2157 YaeQ
Motif
Other DBs
NCBI-GeneID: 937150
NCBI-ProteinID: NP_390989
Pasteur: BG13955
BSORF: BG13955
UniProt: O32082
Position
complement(3190462..3190725)
Genome map
AA seq 87 aa AA seqDB search
MQKYRRRNTVAFTVLAYFTFFAGVFLFSIGLYNADNLELNEKGYYIAVMILVAVGAILTQ
KVTRDNAEDNEIIAEQEKRQNQSHIES
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaatatagacgcagaaacacggttgcctttacagtactagcttattttactttt
tttgcgggagtatttttgtttagtatcggactctataatgctgataatctggaactcaat
gaaaaaggttattacatcgctgttatgatacttgtagcagttggtgcgattcttacgcaa
aaagtgacccgtgataacgcggaggataacgaaatcatcgcggaacaggaaaaaagacaa
aatcaatctcatatcgaatcataa

DBGET integrated database retrieval system