KEGG   Bacillus subtilis subsp. subtilis 168: BSU31120
Entry
BSU31120          CDS       T00010                                 

Gene name
lytG
Definition
(RefSeq) exo-glucosaminidase LytG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glucosaminidase GW Glyco_hydro_11
Other DBs
NCBI-GeneID: 937146
NCBI-ProteinID: NP_390990
Pasteur: BG13954
BSORF: BG13954
UniProt: O32083
Position
complement(3190834..3191682)
AA seq 282 aa
MARKKLKKRKLLISLFFLVSIPLALFVLATTLSKPIEISKETEEIDEQQVFIDSLSGHAQ
ILYEKYHVLPSITIAQAILESDWGNSELAAKANNLFGVKGNYKGHHVTMETDEVEKGKRK
TIRAKFRKYSTFFESMDDHAQLFVRGTSWNKKKYKPVLEAGNYKEAATALQTSGYATDPD
YADKISAIVEKYDLDEYDEVNPSLKSVDLNASIKDSAVQDVWSKPSTDDRSIRLTSAQSY
VGKDIKVVSKKQKGQSVWYQFQINDKLIGWIDDSAVEIKEAT
NT seq 849 nt   +upstreamnt  +downstreamnt
atggcccgtaaaaaacttaaaaaacgtaaactcttgatttcactatttttccttgtatcg
attccgctagctctgtttgttttagcgacaactttatcaaaaccgattgaaatatccaaa
gaaactgaagaaatcgatgaacagcaagtatttatagacagtctgtccggacatgcccaa
attttgtatgaaaaataccatgttctccccagcatcacaattgctcaggccattctcgaa
tcggactgggggaacagtgaactggctgctaaggccaacaacctttttggcgtaaaaggg
aattataaaggccatcatgtcacgatggaaacggacgaagttgaaaaagggaaaagaaaa
accattcgcgcgaagtttcgaaaatacagcacgttttttgaatctatggatgatcacgcc
caattgttcgtccgtggcacatcgtggaataaaaagaagtataaaccggtgcttgaggca
gggaattataaggaagcggcaaccgccctgcaaacatcaggatatgctacagaccctgac
tacgctgacaaaatcagcgctattgtggaaaaatacgatttagatgagtacgatgaggta
aatccatccctcaaatctgtggatttaaacgcctctattaaagacagtgccgttcaagac
gtatggtccaagccttctactgatgatcggtccataaggcttacctctgcccaatcttac
gtcggcaaagacataaaggttgtgtctaaaaaacagaaaggccagtctgtatggtaccaa
ttccaaatcaatgataaacttatcggctggattgatgattcagctgttgaaataaaggag
gcaacctaa

DBGET integrated database retrieval system