KEGG   Bacillus subtilis subsp. subtilis 168: BSU31130Help
Entry
BSU31130          CDS       T00010                                 

Gene name
yubD
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 938834
NCBI-ProteinID: NP_390991
Pasteur: BG13953
BSORF: BG13953
UniProt: O32084
Position
complement(3191843..3193378)
Genome map
AA seq 511 aa AA seqDB search
MKTKHYWVISLLAVLAVGPGLMSNTALSSVQGLVQKTVGTSVFTSVNPILIGNMAFALLV
PAGPLLRKKFGARPVYLASLPVFILGSLLIACSGDIALMAAGRFLQGAATGVMLMIMIPM
LVLSFPIERRNYALLVLIGGFYGSVIIGTILGTIATSCGHWRWLFFIFGTLSLIGVAVSY
FFLHDEHHGAADQEQPLDRAGILLSVFLAAASAVSFIFLQKWGLSSGYVWIGFGVTLCLL
IGLLIVEYKVKNPFISIKLMLLPKPVLGLLIIAAGTITVAVSLSAFQGLLRQMYDISQEH
LILLSLTLLIGVAIAAILSALLYDKVGPGMLGIIGGLILVFVNFQWLHIQDRSSLYMFAA
LFIMLAAGTGLTVAAGLMGAAMGGPLPDLVKRMTAVQFLRLFVYMGVPILIGFFTKKDAA
RQSGSVQDSMMTAYHDLFFISFILSVLLVCLSFCMNATGMGHKLAHKPHDKAKTAPEKPA
VSAQGLSKATVKSYKVINDTEYRNALRNLQK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaaaacactattgggtgatttctttgctcgccgtcttagcggtcgggccggga
ttgatgtctaacacggcattgtcgtcagttcaaggccttgttcagaaaacggttggaaca
agtgtctttacatcagtaaatccgatattgatcggcaatatggcctttgccttgttagtt
ccggcaggaccgctgctgaggaaaaaattcggtgctcgtcccgtctatctggcttcatta
cctgtctttatactaggctcactgctcatcgcatgttcaggcgatattgcattgatggcg
gcagggcgctttttacaaggggcggcaacaggcgtcatgctgatgattatgattccaatg
cttgtactgtcattcccgattgaacgcaggaactatgcactgcttgtgctgatcggggga
ttctatggttctgttatcatcggtacaatcctgggaaccattgcaacaagctgcgggcat
tggagatggctgtttttcatctttggcaccttgtccctgatcggtgtcgcggtgagctat
ttctttcttcatgatgagcatcacggagcggcggatcaagaacagccgcttgatcgtgcg
ggaattcttttatctgtcttccttgccgcagcctcagcggtttcattcatttttctgcaa
aaatgggggctgtcatcgggttatgtatggattggtttcggggtgacgttatgtttgctc
attggtctattgattgtggaatataaagtgaaaaaccccttcatatctattaaactgatg
ctgctgccaaaaccggtgctcggcttattgatcatagctgcagggacgataacggtagct
gtcagcctttctgcttttcaaggcttgctccgtcaaatgtatgatatttctcaggagcat
ctcattcttttaagcttgactcttttaatcggagtggcgatcgcggccattttgagcgct
ctgttatacgataaagtcggaccagggatgctcggtattatcggcggactcattctcgtt
tttgtgaattttcaatggctgcatatacaggatcgatcatctctttatatgttcgcggca
ctgtttatcatgcttgcagcgggaacaggcctgacagtcgccgcagggctgatgggagct
gccatgggaggcccgctgcctgatttggtcaagagaatgacagctgttcagtttttaaga
ttgtttgtctatatgggagttcccattctcatcggctttttcacgaaaaaagatgctgcc
agacaaagcggttcggtacaggattctatgatgactgcttatcatgatctcttcttcatt
tcttttatccttagcgtgctgctcgtctgcctgtcattttgtatgaatgccactggaatg
gggcacaagctggcacataaaccacatgataaagcgaaaacagctccggaaaaaccggcc
gtctcagcacaaggtttgtcgaaggcaactgtcaaatcatataaagtaataaatgatacg
gaatatcggaatgcactcagaaatttacaaaaatag

DBGET integrated database retrieval system