KEGG   Bacillus subtilis subsp. subtilis 168: BSU31150Help
Entry
BSU31150          CDS       T00010                                 

Gene name
yubB
Definition
(RefSeq) undecaprenyl-diphosphatase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU31150 (yubB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU31150 (yubB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     BSU31150 (yubB)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Diphosphatase
   BSU31150 (yubB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BacA
Motif
Other DBs
NCBI-GeneID: 937148
NCBI-ProteinID: NP_390993
Pasteur: BG13951
BSORF: BG13951
UniProt: P94507
Position
complement(3194635..3195465)
Genome map
AA seq 276 aa AA seqDB search
MTLWELFVAAILGIVEGLTEYAPVSSTGHMIIVDDIWLKSSNLMSEEAANSFKVVIQLGS
ILAVAIVFKDRILNLLGLKKNITSDQEQGHKLSIAQIAVGLVPAAVLGFLFEDYIDEYLF
SVKTVAIGLIAGAILMLFADWVNKRKTATDTLDRISYKQAIAVGLFQCLSLWPGFSRSGS
TISGGVILGLNHRAAADFTFIMAMPIMMGASFLSLVKHWDSLSSDLMPFFIVGFICAFVV
ALFVVRFFLRLINKIKLVPFAIYRIILGVILLLIMM
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgactctatgggaattgtttgtagccgccattttaggaatcgtagaaggattaacagag
tacgcgccggtttcttcgacaggacatatgatcatagtagacgacatctggctaaaatca
agtaatctgatgtcagaagaagctgctaactcattcaaggtggttattcagctaggctcc
attttagcagtagctatcgtgtttaaagaccgaattttaaatttactgggcttgaaaaaa
aatattacaagcgaccaggagcagggacataaattaagcattgcccaaattgccgtcgga
ctcgtgcctgcagctgttctcggctttttgtttgaagattacattgatgaatatttattt
tccgttaaaactgtggccatcggtttaattgccggggcaatcctcatgctttttgctgac
tgggtcaataaacggaaaacagcgacagacacactcgaccgcatttcctataaacaggcg
atagccgtcggcttattccaatgtctttccctttggcctggtttctcgcgttcgggttca
accatttccggcggtgttattctcggattaaaccaccgagctgcagccgactttacgttt
attatggcgatgccgatcatgatgggagccagctttctaagcctcgtgaagcattgggac
agcttaagttcggatctgatgccgtttttcatcgtcggctttatctgtgcctttgtggtc
gcactgtttgtcgtccgtttcttcttaaggctgattaacaaaatcaaacttgtcccattt
gcaatctatcgaattattctcggtgtgattttacttttgatcatgatgtaa

DBGET integrated database retrieval system