KEGG   Bacillus subtilis subsp. subtilis 168: BSU31160Help
Entry
BSU31160          CDS       T00010                                 

Gene name
yubA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport
Motif
Other DBs
NCBI-GeneID: 938833
NCBI-ProteinID: NP_390994
Pasteur: BG13950
BSORF: BG13950
UniProt: O32086
Position
complement(3195558..3196724)
Genome map
AA seq 388 aa AA seqDB search
METLQTWSGRFKRFFLDNKFVLFLLVLLLIGLNILVFTKTSFIFTPIIVLLKTISLPIIL
TGIVFYLLNPVVDFLERRRIRRIYSILLLYLLVIGLITITIVSIIPFLKEQIMSLIDNIP
RYVDVVENQTKQLIGSNFVNQAQQTMNINISDLATKVSDQAATIVNSTFTGVGNFIGALT
EIIISIVTVPFILFYLLKDGRKLPVYILKFVPTRLKEQTYTVLSEMNHRLSSYIRGQIIV
SFCIGFLLFIGYLIIGLDYASLLAVIAACTSIVPYLGPTIAITPAIIIAIVTSPLMLLKL
VIVWTIVQLIEGKLISPQIMGKNLHIHPITIIFLLLTAGKLFGVVGIILAIPGYAVAKVI
TTHLFDWFKMQSHLYDEEKNENTPGHKV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggagacgttgcaaacatggagcggcagattcaagcgattcttcttggataataagttt
gttttatttttgcttgtgctgctgctgattggtttaaatattctagtatttacaaaaaca
tcatttattttcaccccgattattgttctgctcaaaacgatatcacttccgattattttg
acaggcattgttttttatctgttaaacccagtcgtcgattttctggagagaagaagaata
agaagaatctattctatattgctgctatacctattggttatcgggctgatcacgatcacg
atcgtgtcgatcattcccttcttaaaagaacaaattatgagtttgattgacaatatcccg
agatatgtggacgtcgtagaaaatcagacgaaacagctgattggcagcaacttcgtcaat
caggcccagcaaacgatgaacattaatatatctgatcttgctacaaaggtttcggatcag
gcagcgacgatcgtgaacagcacctttaccggtgttgggaattttatcggcgcactgact
gagattatcatttcgatcgtcacggttccgtttattctattttatttgctaaaagacgga
agaaaattaccggtctacatactgaagtttgtgccgactcgattgaaagaacagacatat
acagtcttaagcgaaatgaatcatcggttaagctcttatatcagaggccagatcattgtc
agcttctgtatcgggtttttgctgtttatcggttatttgattatcgggctggattatgct
tcattgcttgcagtcattgcggcttgcacaagcatcgttccatatttagggccaacgatt
gccattacgcctgcgattatcattgccatagtgacatcgccgctcatgctgcttaagctg
gtgatcgtttggacgattgttcagctgattgaagggaagctgatctctccgcaaattatg
ggaaaaaaccttcacatccatccgattacgattatttttctgctgttaacagccggcaag
ctgtttggcgttgttggaatcattcttgcgattcccggctatgcggttgccaaagtcatt
acgacacatttatttgactggtttaaaatgcagtcacatttatacgatgaagaaaaaaat
gaaaatacgccggggcataaagtgtga

DBGET integrated database retrieval system