KEGG   Bacillus subtilis subsp. subtilis 168: BSU31170Help
Entry
BSU31170          CDS       T00010                                 

Gene name
yulF
Definition
(RefSeq) oxidoreductase
  KO
K22230  scyllo-inositol 2-dehydrogenase (NADP+) [EC:1.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU31170 (yulF)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BSU31170 (yulF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA NAD_binding_3 GFO_IDH_MocA_C
Motif
Other DBs
NCBI-GeneID: 937153
NCBI-ProteinID: NP_390995
Pasteur: BG12388
BSORF: BG12388
UniProt: O05265
Position
3196906..3197892
Genome map
AA seq 328 aa AA seqDB search
MIRFAIIGTNWITDRFLESAADIEDFQLTAVYSRSAERAGEFAAKHNAAHAFSDLQEMAA
SDCFDAVYIASPNALHKEQAVLFMNHGKHVLCEKPFASNTKETEEMISAAKANGVVLMEA
MKTTFLPNFKELKKHLHKIGTVRRFTASYCQYSSRYDAFRSGTVLNAFQPELSNGSLMDI
GVYCIYPAVVLFGAPKDVKANGYALSSGVDGEGTVILSYDGFEAVLMHSKISTSYAPAEI
QGEDGTIVIDTIHRPERVEIRYRDGRLENIAIPDPKPAMFYEAEEFVTLIKENKLESEEN
TFERSLTTAKIMEEARKQMGIVYPADQA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgatacgttttgcaataataggaaccaactggattacagaccgctttcttgagtcagca
gcggatatcgaagattttcagctgactgctgtttattcaagatcggctgaacgcgctggc
gagtttgctgctaaacacaacgctgcgcatgccttctcagaccttcaggaaatggcggcg
agcgattgctttgatgccgtatacatagcgagcccgaacgctcttcacaaggaacaagcc
gttctctttatgaaccatggcaagcatgtgctttgtgagaagccgtttgcttcgaataca
aaagaaacagaagagatgatctcagcggctaaggcaaacggcgttgttctcatggaagca
atgaagaccactttcctgccgaatttcaaagaactgaaaaaacacctgcataaaatcggc
actgtccgcagatttaccgcaagctactgccagtattcctcacgatatgacgcgttcaga
agcggaactgttttgaatgcgtttcagcctgagctttccaatgggtcattaatggatatt
ggcgtctattgtatttatccggctgttgtgttgtttggcgcgccgaaggatgtaaaagca
aacggatatgctttatcctccggagtggacggagaaggaactgtcattctgtcttacgac
gggttcgaagctgttctgatgcattccaaaatctctacttcctatgccccggctgaaatc
cagggtgaagacgggacgattgtaatcgatacgattcaccggcctgaacgtgttgaaatc
cgctaccgggacggccgccttgaaaacatcgcgatccctgatcctaaaccggcgatgttc
tatgaagcagaagaatttgtcacgcttataaaagagaataagctggaatctgaagaaaat
acatttgaacggtctttgaccaccgcaaaaattatggaagaagcaagaaagcaaatgggg
attgtataccctgctgatcaagcttaa

DBGET integrated database retrieval system