KEGG   Bacillus subtilis subsp. subtilis 168: BSU31180Help
Entry
BSU31180          CDS       T00010                                 

Gene name
yulE
Definition
(RefSeq) L-rhamnose isomerase
  KO
K01813  L-rhamnose isomerase [EC:5.3.1.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU31180 (yulE)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.14  L-rhamnose isomerase
     BSU31180 (yulE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RhaA
Motif
Other DBs
NCBI-GeneID: 938836
NCBI-ProteinID: NP_390996
Pasteur: BG12387
BSORF: BG12387
UniProt: O05264
Position
complement(3197933..3199207)
Genome map
AA seq 424 aa AA seqDB search
MTIKANYDSAKQAYEKWGIDVEEALRQLEQVPISIHCWQGDDIEGFEVNKGELSGGIDVT
GNYPGKAQTPEELRRDLEKALSLIPGKHRVNLHAIYAETNREAVERDELKPQHFENWVKW
AKNLGLGLDFNPTLFSHEKAADGLTLSHPDPDIREFWIRHCIACRRIGEYFGKELGTPCL
TNIWIPDGYKDIPSDRLTPRKRLKESLDRIFSEEISEQHNLDSIESKLFGLGSESYVVGS
HEFYLAYALTNHKLCLLDTGHFHPTETVSNKISSMLLYTDKLALHVSRPVRWDSDHVVVL
DDELREIALEIVRNHALEKVAIGLDFFDASINRVAAWTIGTRNMIKALLYALLLPNGYLK
QLQEEGRYTERLALMEEFKTYPFGAIWDSYCEQMGVPVKEAWLYDIKEYEQQVLLKRKAS
SPIV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaccataaaagccaattatgacagtgcaaaacaggcatatgaaaaatggggaattgat
gttgaagaggcgcttcggcaattagagcaagtgcccatttcgatccactgctggcagggt
gacgacattgaaggctttgaagtaaataagggcgagctttcaggcggaattgacgtgacc
ggcaattatcccggaaaagcgcaaactcctgaagaattaagaagagatttggagaaggct
ctttctctcattcctggaaagcaccgcgtaaacctgcatgcgatatacgcagaaacaaac
agggaagcggtagaacgtgacgaattgaagccgcagcattttgaaaactgggtgaaatgg
gcaaaaaaccttggtctcggtttagattttaatccaaccttgttttcgcatgagaaagcg
gctgacggactcaccctttcacaccctgatccggacatcagagaattttggatcaggcat
tgcatcgcttgccgccgtatcggggaatacttcgggaaagaattaggaacaccttgcttg
acgaatatttggattcccgacggctataaggatatcccgagtgataggctgacaccgcgt
aaaagactaaaagaatcactggatcggatcttctcagaggagatcagtgaacaacataat
cttgattcaatcgagagcaagctgttcgggcttggctccgaatcatatgttgtcggatct
catgaattttatttagcttatgctttgacgaatcataagctttgtttacttgatacaggc
catttccatccgactgagacggtatcaaacaagatctcgtccatgctgctttacacagac
aagcttgccttgcacgtatcgcggcctgttcgttgggatagcgaccatgtagtggttttg
gatgatgaattgagagaaatcgctcttgaaattgtacgaaatcatgctcttgagaaggta
gccatcggtctggattttttcgatgccagcattaaccgtgtagccgcctggaccatcgga
acgagaaatatgatcaaagctttattgtatgccctgcttctcccgaacggatatttaaaa
caattgcaggaagagggccgctatacagaaaggctggccctgatggaggaattcaaaaca
tatcctttcggagccatctgggattcctactgtgagcaaatgggcgttccggtaaaagag
gcatggctttatgacatcaaagaatatgagcaacaggtgcttttaaaaaggaaggcatct
tctccgattgtctaa

DBGET integrated database retrieval system