KEGG   Bacillus subtilis subsp. subtilis 168: BSU31190Help
Entry
BSU31190          CDS       T00010                                 

Gene name
yulD
Definition
(RefSeq) L-rhamnose mutarotase
  KO
K03534  L-rhamnose mutarotase [EC:5.1.3.32]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU31190 (yulD)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.32  L-rhamnose mutarotase
     BSU31190 (yulD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rhaM DRE2_N
Motif
Other DBs
NCBI-GeneID: 937151
NCBI-ProteinID: NP_390997
Pasteur: BG12386
BSORF: BG12386
UniProt: O05263
Position
complement(3199233..3199547)
Genome map
AA seq 104 aa AA seqDB search
MKRKASIMFVHQDKYEEYKQRHDDIWPEMAEALKAHGAHHYSIFLDEETGRLFAYLEIED
EEKWRKMADTEVCQRWWKSMAPLMKTNSDFSPVAIDLKEVFYLD
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagaaaagccagtatcatgtttgtccatcaagacaagtacgaagaatacaaacag
cggcatgatgacatttggcctgagatggcagaagcactcaaagctcatggagcacaccat
tattccatttttctagacgaggaaacaggcaggctttttgcatatttagaaatagaggat
gaagagaaatggagaaagatggcggacacggaagtttgccaaagatggtggaaatcgatg
gcgccattaatgaaaacaaattcggatttcagtcctgttgcgatagatctaaaggaagtt
ttttatttggattga

DBGET integrated database retrieval system