KEGG   Bacillus subtilis subsp. subtilis 168: BSU31200Help
Entry
BSU31200          CDS       T00010                                 

Gene name
yulC
Definition
(RefSeq) rhamnulokinase
  KO
K00848  rhamnulokinase [EC:2.7.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00051  Fructose and mannose metabolism
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU31200 (yulC)
   00051 Fructose and mannose metabolism
    BSU31200 (yulC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.5  rhamnulokinase
     BSU31200 (yulC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C Inj_translocase YpsA
Motif
Other DBs
NCBI-GeneID: 938839
NCBI-ProteinID: NP_390998
Pasteur: BG12385
BSORF: BG12385
UniProt: O05262
Position
complement(3199565..3201022)
Genome map
AA seq 485 aa AA seqDB search
MIYTAIDVGASSGRIMVGELNEGKLDIQEIHRFANGFSQRDGHCLWDIDHLLKQILQGLQ
KVKTLGYEHCTVGIDTWAVDYVLLDEKGDRLREAISYRDRRTDHTIDKLEHTLSKAAIYQ
KTGIQFQPFNTIYQLFEEDRELLKKTDKIMMIPDYLGYCLTGKAVTEITNVSTTQLLNVS
TGNLDPELLEAVSVLEQQFAPLTEPGCELGKLRNEWFPDYDLPACKVMTVATHDTASAVI
AAPGVNDGWAYISSGTWSLIGVENKTPIITDLALENNYTNERGANNTIRFLKNIIGMWVI
QEVKQQLQADYSFQQLAEEAKKTEPFQQFINLNDKRFLNPENMIKEIQHYCRQTRQKIPR
TAGELACCIYSNLAIIYAIAIKELETITEKPIEQFHIIGGGARNDFLNQLTADMSGKAVY
AGPIEATATGNLLMQMIAAKEVKDIKEARQVVRNSFPIKVFTPKDIDRSTIIQSFQQTVL
KALSK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgatttatactgccattgatgtaggcgcatcaagcgggagaatcatggtaggtgaactg
aatgaagggaagcttgacatacaagagattcacaggttcgctaacggtttcagtcaaaga
gacgggcattgcttatgggatattgatcatttgctaaaacaaatcctgcaaggactgcaa
aaagtaaagacgcttgggtatgaacactgcaccgtaggcattgatacatgggcagtcgat
tatgtcttactggacgaaaaaggcgatcggttgcgggaagcaatctcctaccgtgataga
agaacagatcacacaatagacaaactggaacataccctctcaaaagccgcaatttatcaa
aaaacaggaatacaatttcagcctttcaacacgatctatcaattgtttgaagaagaccgt
gagctgctgaaaaagacagacaaaattatgatgattcctgattatttaggctattgttta
accggaaaagctgtaacggaaatcacaaacgtgtccacaacacagcttttaaacgtctca
acgggaaatcttgatcctgaattgcttgaagccgtgtctgttctggaacagcaatttgcg
ccgctcactgaaccggggtgtgaactcgggaagctaagaaatgagtggttcccggattat
gatctcccggcgtgcaaggtgatgacagtcgcaacacatgatacggcctcggccgtcatt
gcggcgccaggcgtaaatgatggctgggcgtatatcagcagcggaacatggtcgttaatc
ggggttgaaaacaaaacaccgataataactgatcttgctttagaaaacaactatacaaat
gaacgcggcgcaaacaacaccattcgctttctcaaaaacattatcggcatgtgggtgata
caagaagtcaaacagcagctacaagcagattattcttttcagcagcttgcagaagaagcc
aaaaaaacagaaccattccagcaatttataaacttaaatgataaacgtttcctgaatcca
gaaaacatgataaaggaaatacaacattattgcagacaaacccgccaaaagattccccgt
actgcaggcgaacttgcctgctgcatctacagcaatttagccatcatctatgcgatagcc
atcaaagagctcgaaacaatcacagaaaaaccgatcgagcaatttcatatcatcggcggc
ggagcccggaatgatttcttaaatcaattaacggcagacatgagtggaaaagcggtatat
gcagggccgatagaggcaactgccaccggaaatcttttgatgcaaatgattgctgccaaa
gaagtcaaagacataaaagaagcccggcaagtcgtcagaaattcctttccgatcaaagtg
tttacacctaaagacattgatagaagcacgatcattcagtcatttcagcaaactgttttg
aaagcgctatctaaatga

DBGET integrated database retrieval system