KEGG   Bacillus subtilis subsp. subtilis 168: BSU31200Help
Entry
BSU31200          CDS       T00010                                 

Gene name
yulC
Definition
(RefSeq) rhamnulokinase
  KO
K00848  rhamnulokinase [EC:2.7.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00051  Fructose and mannose metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU31200 (yulC)
   00051 Fructose and mannose metabolism
    BSU31200 (yulC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.5  rhamnulokinase
     BSU31200 (yulC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C Inj_translocase YpsA
Motif
Other DBs
NCBI-GeneID: 938839
NCBI-ProteinID: NP_390998
Pasteur: BG12385
BSORF: BG12385
UniProt: O05262
Position
complement(3199565..3201022)
Genome map
AA seq 485 aa AA seqDB search
MIYTAIDVGASSGRIMVGELNEGKLDIQEIHRFANGFSQRDGHCLWDIDHLLKQILQGLQ
KVKTLGYEHCTVGIDTWAVDYVLLDEKGDRLREAISYRDRRTDHTIDKLEHTLSKAAIYQ
KTGIQFQPFNTIYQLFEEDRELLKKTDKIMMIPDYLGYCLTGKAVTEITNVSTTQLLNVS
TGNLDPELLEAVSVLEQQFAPLTEPGCELGKLRNEWFPDYDLPACKVMTVATHDTASAVI
AAPGVNDGWAYISSGTWSLIGVENKTPIITDLALENNYTNERGANNTIRFLKNIIGMWVI
QEVKQQLQADYSFQQLAEEAKKTEPFQQFINLNDKRFLNPENMIKEIQHYCRQTRQKIPR
TAGELACCIYSNLAIIYAIAIKELETITEKPIEQFHIIGGGARNDFLNQLTADMSGKAVY
AGPIEATATGNLLMQMIAAKEVKDIKEARQVVRNSFPIKVFTPKDIDRSTIIQSFQQTVL
KALSK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgatttatactgccattgatgtaggcgcatcaagcgggagaatcatggtaggtgaactg
aatgaagggaagcttgacatacaagagattcacaggttcgctaacggtttcagtcaaaga
gacgggcattgcttatgggatattgatcatttgctaaaacaaatcctgcaaggactgcaa
aaagtaaagacgcttgggtatgaacactgcaccgtaggcattgatacatgggcagtcgat
tatgtcttactggacgaaaaaggcgatcggttgcgggaagcaatctcctaccgtgataga
agaacagatcacacaatagacaaactggaacataccctctcaaaagccgcaatttatcaa
aaaacaggaatacaatttcagcctttcaacacgatctatcaattgtttgaagaagaccgt
gagctgctgaaaaagacagacaaaattatgatgattcctgattatttaggctattgttta
accggaaaagctgtaacggaaatcacaaacgtgtccacaacacagcttttaaacgtctca
acgggaaatcttgatcctgaattgcttgaagccgtgtctgttctggaacagcaatttgcg
ccgctcactgaaccggggtgtgaactcgggaagctaagaaatgagtggttcccggattat
gatctcccggcgtgcaaggtgatgacagtcgcaacacatgatacggcctcggccgtcatt
gcggcgccaggcgtaaatgatggctgggcgtatatcagcagcggaacatggtcgttaatc
ggggttgaaaacaaaacaccgataataactgatcttgctttagaaaacaactatacaaat
gaacgcggcgcaaacaacaccattcgctttctcaaaaacattatcggcatgtgggtgata
caagaagtcaaacagcagctacaagcagattattcttttcagcagcttgcagaagaagcc
aaaaaaacagaaccattccagcaatttataaacttaaatgataaacgtttcctgaatcca
gaaaacatgataaaggaaatacaacattattgcagacaaacccgccaaaagattccccgt
actgcaggcgaacttgcctgctgcatctacagcaatttagccatcatctatgcgatagcc
atcaaagagctcgaaacaatcacagaaaaaccgatcgagcaatttcatatcatcggcggc
ggagcccggaatgatttcttaaatcaattaacggcagacatgagtggaaaagcggtatat
gcagggccgatagaggcaactgccaccggaaatcttttgatgcaaatgattgctgccaaa
gaagtcaaagacataaaagaagcccggcaagtcgtcagaaattcctttccgatcaaagtg
tttacacctaaagacattgatagaagcacgatcattcagtcatttcagcaaactgttttg
aaagcgctatctaaatga

DBGET integrated database retrieval system