KEGG   Bacillus subtilis subsp. subtilis 168: BSU31210Help
Entry
BSU31210          CDS       T00010                                 

Gene name
yulB
Definition
(RefSeq) DeoR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoRC HTH_DeoR HTH_11 GntR FaeA HTH_Mga HTH_Crp_2 HTH_5
Motif
Other DBs
NCBI-GeneID: 938838
NCBI-ProteinID: NP_390999
Pasteur: BG12384
BSORF: BG12384
UniProt: O05261
Position
complement(3201027..3201803)
Genome map
AA seq 258 aa AA seqDB search
MLVAERQQKIVEIVNMRSSIRVSELSDIFSVTEETIRRDLEKLEKEHKLSRSHGGAVSIQ
QKESEIHFSEREITNVIEKKAIAHEAAKYVKSGDRIILDASTTAWYMAKILPDIELTVIT
NSMKAAIELSNKENISVISTGGILLEKSLSFAGPLAERSLETYHVNKTFLSCKGFDVHNG
MSDSNEWQALLKKRMIERSDQTILMADSSKWGNREFSHIASLQDVSRLITDSGLDPASVK
ALEDKKVKVTAVPLSKRG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctagtagcagaacggcagcaaaaaatagtggaaatagtaaatatgcgttcaagcatc
cgcgtttccgaattaagtgacattttttcagtcacagaggaaaccattcggcgtgatctt
gaaaagcttgaaaaagaacataaactgagccggagccacggaggagcggtcagtattcag
cagaaggaatcagaaattcatttttctgaacgggaaatcacgaatgtcatcgaaaaaaaa
gccatcgctcacgaagcggccaaatatgtaaaaagcggagaccgaatcattctcgatgca
agcacaaccgcttggtacatggcaaaaatactccctgacattgagctcaccgtgattaca
aactcaatgaaagcagctattgaactcagcaataaagaaaacatatcagtcatttcaaca
ggcggcattttgctggaaaaatcattatcatttgccggcccgttagcagagcgttcactt
gagacctatcatgtcaataaaacctttctgtcatgtaagggatttgacgtacacaacggg
atgagtgattcaaatgagtggcaggcgctgctcaaaaaacggatgatcgaaaggtcggac
cagaccattttgatggccgattcaagcaaatgggggaaccgcgagttttcacatatcgcc
tcgctgcaagatgtcagccgccttattacggattctggacttgatccggcatcggtaaaa
gctcttgaggacaaaaaggtgaaggtgacagctgttcctctttcgaagagagggtga

DBGET integrated database retrieval system