KEGG   Bacillus subtilis subsp. subtilis 168: BSU31220
Entry
BSU31220          CDS       T00010                                 

Symbol
yuxG
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short_C2 adh_short Aldolase_II KR Epimerase GDP_Man_Dehyd Polysacc_synt_2 F420_oxidored NAD_binding_10 3Beta_HSD UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 938841
NCBI-ProteinID: NP_391000
Pasteur: BG10947
BSORF: BG10947
UniProt: P40747 A0A6M3ZIW3
Position
complement(3201860..3203929)
AA seq 689 aa
MVKHIWDSERAAQLPKGVEELVYRSNLIGSDRTVCNWGGGNTSMKTTEKDFRGREIEVMW
VKGSGSDLATMKAHNFSGLKLDDIRPLIKRDQMPDEEMVDYLSHCMIDSKHPRPSIETLL
HAFLPYKHVDHTHPDAIISICCADNGKQIAEDIYGNRFVWVPYVRPGFTLSKMIAEGVAN
NPHAELVLMEKHGLVTWGETSETCYQKTISIIQEAEQYINDRINQHEVFGGKRYQPLPED
KRKQILAGIMPVIRGAVSEEKKMILSYDDHDDVLEFVNSVQAPALSQIGAACPDHLVHTK
RVPLYIDWNPETQDVHKLADLIKSGVETFTSEYQAYFTRNQQDGDQIFESAPRVILIPGI
GMVNTGKSYAMSKVSGALYRRAIAVMKGATALGQFVSLHENESYHVEYWPLELYKLTLAP
PEAEFSRKVALITGGAGGIGSAACRRFAAEGGHVIVADLNIEGAQKIAGEINDAYGKGRA
MAVKMDVTKEEDVQSAFERAALAYGGIDIVVNNAGLATSSPFDETSLKEWNLNMNVLGTG
YFLVAREAFKQMKHQNRGGSMVFVGSKNSVYAGKNASAYSSVKALETHLARCIAAEGGEF
GIRVNSVLPDAVLQGSAIWGSSWREERAAAYGIEPDQLEEHYRKRTALLVNIYPEDIAEA
IAFFASSKAEKTTGCMITVDGGVPAAFTR
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggtgaaacatatatgggattcagagcgagctgcacagctacctaaaggtgtagaggaa
ttggtgtacaggtccaatctgatcgggtcagaccgcactgtctgcaactggggcgggggg
aatacatctatgaaaacaacggaaaaggattttagaggccgtgaaatagaagtcatgtgg
gtaaaaggaagcggatcggatttggcaacaatgaaagcgcataacttttccggtttgaaa
ttagatgatatccgcccgctgattaaaagggaccaaatgcccgatgaagaaatggtagac
tacctgtctcattgtatgatagacagcaaacatccccgcccttcaattgaaacgctatta
cacgcttttctgccatacaaacatgttgaccatacccatccagatgcgattatcagcata
tgctgtgcggataatggaaaacaaatcgctgaagacatttacggaaatcggtttgtatgg
gtgccatacgtccgtcctggatttactttgtctaaaatgatcgctgaaggcgtagcaaac
aacccccacgccgagcttgtattaatggagaaacacggcttagtcacttggggagagacg
tctgaaacatgttatcaaaaaacgatatccatcattcaagaagccgagcagtatattaac
gatcgtatcaatcagcatgaggtattcggaggcaaaaggtatcagccgctgccggaggat
aaaagaaaacaaatcttggcaggcatcatgcctgtgatcagaggagcagtaagtgaagaa
aagaaaatgatcctttcctatgatgatcatgacgatgtcttggaatttgtaaacagtgtc
caagcgccagcactttcgcaaatcggtgcggcatgcccggatcaccttgttcacacaaaa
cgggttccgctgtacattgattggaatccggaaactcaagatgtgcacaagcttgcagat
ctgatcaagtcaggagtcgagacctttacatcagagtatcaggcttactttacacgcaat
cagcaggatggggatcaaatctttgaatccgccccgcgggtgatattgattcctggaatc
ggaatggtgaatacaggaaaaagttatgcgatgtctaaagtaagcggggctttatatcgg
agggccatcgccgtaatgaaaggagcaaccgctctggggcaatttgtttctttacatgaa
aatgagtcctaccatgtcgaatattggccgctcgaactatataaactcacgctggccccg
ccggaagcagaattttcccgaaaagtagcgctgataactggaggagccggcggaatcggc
agtgcggcatgccgccgatttgcagctgagggagggcacgtgatcgtagctgatctgaat
atagaaggcgcacagaaaattgccggggaaataaacgatgcatacggaaaaggacgggca
atggctgtcaaaatggatgtgacaaaggaggaagacgtacagtcagcttttgaacgagcg
gcgcttgcttacggcggcattgatatcgtcgtcaataatgccgggctggccacatcaagc
ccatttgacgaaacaagtctaaaagaatggaatcttaatatgaatgttttaggaacaggc
tatttccttgtagcccgtgaagcgtttaaacagatgaaacatcaaaatagaggcggaagc
atggtatttgtcggatcgaaaaattcagtttatgcgggaaaaaacgcctctgcctacagc
tctgttaaggcgcttgaaacccatttagcaagatgcatcgcagcagaaggcggagaattc
ggcattagggtcaactccgttttgcctgatgcagttcttcaaggatcggcaatctggggt
tcaagctggcgtgaggaacgagccgcggcgtacgggattgaaccggatcagctggaggaa
cattaccggaaacggacagcattgctcgtcaatatttacccggaggatattgccgaagcc
attgcattcttcgcttcttccaaagccgaaaaaacaacgggctgcatgatcacggtagac
ggcggcgtccctgctgcttttacgcgttag

DBGET integrated database retrieval system