KEGG   Bacillus subtilis subsp. subtilis 168: BSU31230Help
Entry
BSU31230          CDS       T00010                                 

Gene name
tlpB
Definition
(RefSeq) methyl-accepting chemotaxis protein TlpB
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU31230 (tlpB)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU31230 (tlpB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU31230 (tlpB)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU31230 (tlpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal dCache_1 HAMP BLOC1_2 dCache_2 LXG DASH_Dad2 AI-2E_transport UPF0242 GlcNAc-1_reg DUF1664
Motif
Other DBs
NCBI-GeneID: 937152
NCBI-ProteinID: NP_391001
Pasteur: BG10862
BSORF: BG10862
UniProt: P39217
Position
complement(3204067..3206055)
Genome map
AA seq 662 aa AA seqDB search
MGKFIQWIKQPSISKPLIAAFLAVLILPVGVLAYFSYQSAWNALDRELISSAKGNVEELN
STLQNKLEDKVKAIDYYSETVDKDILLGKNKTLLKEKFKQYTTLNDDVGAIYAASEDKKL
YKYPDSGVPKGFDPTGRDWYKQAVAEKGQAVFSEPYTDEATGDIVVTISKQLKDGSGVIA
LDLNLDEVLTASKRIKIGKEGFAFITTGNKKYIAHPTIKPGTTGSGDWTNQVYSKKEGSF
EYTFEGKEKKMAFTTNKLTGWKIAGTYFVSELQDASSPVLNTAVIILCVSIVIGGILILY
IIRAITKPLRKLVSTSAKISSGDLTEVIDIHSKNEFGQLGESFNEMSASLRSVIGVIQTS
VENVASSSEELTASAAQTSKATEHITLAIEQFSDGNEAQSEKLETSSNHLSQMNEGISKV
AQASSTITKSSIQSSEAAGSGEKLVEHTVGQMKTIDQSVQKAEAVVKGLETKSQDITSIL
NVINGIADQTNLLALNAAIEAARAGEYGRGFSVVAEEVRKLAVQSADSAKEIEGLIQEIV
REISTSLSMFQSVNHEVKEGLQITDQTAESFKQIYEMTTQISGELQNLNATVEQLSAGSQ
EVSSAVEDISAVAKESSAGIQDIAASAEEQLASMEEISSSAETLANMAEELQDITKKFKI
ES
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaattcatacaatggatcaaacagccatcgatcagcaaaccgctaatcgctgcg
tttctggcagtgcttattttgccggttggggttttagcatatttcagttatcaatcagct
tggaacgcgttagacagagagctcataagcagtgcgaagggaaatgttgaagaactaaac
agtacgctgcaaaataaattagaagataaagtaaaagcaatagattattatagtgagaca
gtcgataaagacatattgttaggcaaaaacaaaacattactgaaagagaaatttaagcag
tacacgacacttaacgacgatgtaggcgcaatctatgctgcctcagaagataagaagctt
tataaatatccggatagcggtgttccgaaaggtttcgatccgacaggacgtgactggtac
aaacaggcggttgcggaaaaaggacaagctgttttctcagaaccgtataccgatgaagcg
acaggagatatcgttgtcacaatttcaaaacaattaaaagacggttcaggggttatagcg
ctagatttaaacctggatgaagtgcttactgcatcaaaaagaatcaaaatcggaaaagaa
ggctttgcatttattacgacaggcaacaaaaaatatatcgcccatccgaccattaagccg
gggacaaccggttccggcgattggacaaaccaagtatattccaaaaaagaaggctcattt
gaatatacattcgaaggcaaagaaaagaaaatggcctttacgacaaataaactgactggc
tggaaaatcgcgggcacatattttgtcagtgaattgcaagatgcttcaagcccggtgctg
aacactgcggttatcattctatgcgtgtcaatagtaatcggcggcatactcatactctat
attatccgtgccatcaccaagccgttaagaaaacttgtctcaacgtctgcaaaaatcagc
agcggagatctcacagaagtcattgacattcactcgaaaaacgagtttggccagcttggc
gaaagctttaatgaaatgtctgcatcattgcgttctgtaataggcgttattcaaacgtct
gtagaaaacgtcgcttcatcttctgaggagctgacagcaagcgcagcccaaacaagcaag
gcaactgaacatattacacttgccatcgaacagttctcagatggcaacgaggcacaaagc
gagaaactggaaacaagctcaaatcatctttctcaaatgaacgaggggatttcaaaagtg
gctcaagcctcttcaaccattacgaaatcatcgattcagtcctctgaggcagcgggcagc
ggagaaaagctggtggagcatacagtcggccagatgaaaacaattgaccaatccgttcaa
aaagcggaagcggttgtgaagggccttgaaacaaaatcgcaagacatcacaagcatcttg
aatgtgattaacggcattgctgatcaaaccaacctgcttgcattaaatgctgcgattgag
gcggcaagagcgggagaatacggaagaggtttctcagtagttgcggaagaggttagaaaa
cttgctgtacaatcagcagactccgccaaggaaattgaaggattaattcaagagattgtc
agggaaatcagcacctcactttcaatgttccaatccgtgaatcatgaagtgaaagaaggc
ttgcagattacggatcaaacagcggaaagctttaaacaaatctatgagatgacaacccaa
atttccggcgaattgcaaaacttgaacgcgacggttgaacaactgtcagccggatcacag
gaagtgtcaagtgctgttgaagatatttctgcagtggcgaaagaaagctcagcaggcatt
caggatatcgcagcttcggcggaagaacagcttgcgtccatggaagaaatcagctcttca
gcggaaacgttggcaaacatggcggaagaacttcaggacattacgaagaaatttaaaata
gaatcataa

DBGET integrated database retrieval system