KEGG   Bacillus subtilis subsp. subtilis 168: BSU31270
Entry
BSU31270          CDS       T00010                                 

Gene name
tgl
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase
  KO
K00686  protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU31270 (tgl)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     BSU31270 (tgl)
SSDB
Motif
Pfam: TGL
Other DBs
NCBI-GeneID: 937158
NCBI-ProteinID: NP_391005
Pasteur: BG10946
BSORF: BG10946
UniProt: P40746 A0A6M4JMD6
Structure
PDB: 
4P8I 4PA5

Position
3212591..3213328
AA seq 245 aa
MIIVSGQLLRPQDIENWQIDQDLNPLLKEMIETPVQFDYHSIAELMFELKLRMNIVAAAK
TLHKSGAKFATFLKTYGNTTYWRVSPEGALELKYRMPPSKAIRDIAENGPFYAFECATAI
VIIYYLALIDTIGEDKFNASFDRIILYDWHYEKLPIYTETGHHFFLGDCLYFKNPEFDPQ
KAQWRGENVILLGEDKYFAHGLGILNGKQIIDKLNSFRKKGALQSAYLLSQATRLDVPSL
FRIVR
NT seq 738 nt   +upstreamnt  +downstreamnt
atgattattgtatcaggacaattgctccgtccccaggatattgaaaattggcagattgat
caagatctgaatccgctcttaaaagagatgattgagacgcctgttcagtttgattatcat
tcaattgctgaactgatgtttgagcttaaactgcggatgaatattgtagcagcggcaaag
acgctgcacaaaagcggggcgaagtttgccacttttttaaaaacatacgggaatacaacg
tattggagggtttcaccggagggcgccttggagctgaaatacagaatgccgccttcaaaa
gcgattcgggacattgcagagaacggcccgttttatgcgtttgaatgcgcaaccgcaatc
gttatcatttattacttggccttaatcgatacaatcggagaagataaattcaatgccagc
tttgacagaattattttatatgactggcattatgagaaattgccgatatatacggaaaca
ggacaccactttttccttggagattgtttgtattttaagaatcctgaatttgatccgcaa
aaggcgcaatggagaggcgaaaatgtgatactactgggggaagataaatattttgcccat
ggtcttggaatcttaaacggaaagcaaattattgataagctgaattcttttaggaaaaaa
ggagccttacagtcagcctaccttctgtctcaggcgaccagactggatgttccgtctctt
ttccgcatcgtccgctaa

DBGET integrated database retrieval system