KEGG   Bacillus subtilis subsp. subtilis 168: BSU31279Help
Entry
BSU31279          CDS       T00010                                 

Gene name
yuzH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8303174
NCBI-ProteinID: YP_003097776
UniProt: C0H3Q3
Position
complement(3213342..3213596)
Genome map
AA seq 84 aa AA seqDB search
MNILQYSYKKRGKIEFVFEGWPHSKVTMVPIKGYYFVRFIKWSSQDPIVTRNDLEKMEWA
ANQYFGTAPFYRKRKAFETPSSGK
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcttcaatattcttataaaaaaagagggaaaattgagtttgtatttgaaggc
tggcctcactcaaaagttacaatggttcctatcaaaggctactattttgtccgctttatc
aaatggagcagccaggatccaatcgtgacaagaaatgaccttgaaaaaatggagtgggct
gcgaaccaatattttggcacagcccccttctatcgaaaacgaaaggcatttgaaacccca
tcgtccggaaaatag

DBGET integrated database retrieval system