KEGG   Bacillus subtilis subsp. subtilis 168: BSU31279
Entry
BSU31279          CDS       T00010                                 

Symbol
yuzH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303174
NCBI-ProteinID: YP_003097776
UniProt: C0H3Q3 A0A6M4JN93
Position
complement(3213342..3213596)
AA seq 84 aa
MNILQYSYKKRGKIEFVFEGWPHSKVTMVPIKGYYFVRFIKWSSQDPIVTRNDLEKMEWA
ANQYFGTAPFYRKRKAFETPSSGK
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaacattcttcaatattcttataaaaaaagagggaaaattgagtttgtatttgaaggc
tggcctcactcaaaagttacaatggttcctatcaaaggctactattttgtccgctttatc
aaatggagcagccaggatccaatcgtgacaagaaatgaccttgaaaaaatggagtgggct
gcgaaccaatattttggcacagcccccttctatcgaaaacgaaaggcatttgaaacccca
tcgtccggaaaatag

DBGET integrated database retrieval system