KEGG   Bacillus subtilis subsp. subtilis 168: BSU31280
Entry
BSU31280          CDS       T00010                                 

Gene name
yugU
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: UPF0047
Other DBs
NCBI-GeneID: 937156
NCBI-ProteinID: NP_391006
Pasteur: BG12373
BSORF: BG12373
UniProt: O05243 A0A6M3ZG03
Position
complement(3213854..3214252)
AA seq 132 aa
MLKTLQIKTTKRDEMIDITREVEAFLQETGITSGAALIYCPHTTAGITINENADPDVKKD
MLRRFDEVYPWEHELDRHMEGNTAAHMKSSTVGASQHVIVENGRLILGTWQGIYFCEFDG
PRTRTCYIKMMG
NT seq 399 nt   +upstreamnt  +downstreamnt
atgctgaaaacactgcaaatcaaaacaaccaaacgagatgaaatgatagatatcacccgg
gaggtggaagcgtttcttcaagaaacaggtataacgagcggcgcagcgctgatttactgt
ccgcatacgactgcgggcattacaattaatgaaaatgccgatccggacgtcaaaaaagat
atgctcagaaggtttgatgaggtatatccgtgggaacatgagctggaccgccatatggag
ggcaatacagctgcacacatgaagtcgagtacggtcggagcttcacagcatgtcattgtg
gaaaacggccggcttattcttggaacgtggcagggcatttatttctgcgaatttgacggg
cctcgcacccggacatgctatatcaaaatgatgggataa

DBGET integrated database retrieval system