KEGG   Bacillus subtilis subsp. subtilis 168: BSU31290Help
Entry
BSU31290          CDS       T00010                                 

Gene name
yugT
Definition
(RefSeq) oligo-1,6-glucosidase 3
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00052  Galactose metabolism
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BSU31290 (yugT)
   00500 Starch and sucrose metabolism
    BSU31290 (yugT)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     BSU31290 (yugT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 938857
NCBI-ProteinID: NP_391007
Pasteur: BG12372
BSORF: BG12372
UniProt: O05242
Position
complement(3214372..3216036)
Genome map
AA seq 554 aa AA seqDB search
MKKAWWKEAVVYQIYPRSFKDSNGDGIGDIQGIRTKLSYIKELGADVIWICPLYDSPNAD
NGYDIRDYQNILSEFGTMEDFDELLGDIHDLDMKLIMDLVVNHTSDEHPWFIESRSSIHS
EKRDWYIWKDGKNGKTPNNWESIFGGPAWEYDQKTSQYYLHLFDKKQPDLNWENEKVRNA
VYDMINWWLDKGIDGFRVDAITHIKKKEGFPDMPNPKGLDYVPSFPYHMNADGIMDLLTE
LKENTFSRYPIMTVGEANGVAAKEAADWAGEKNGIFSMIFQFEHLGLWDVEINESIDIVA
FKRILTDWQDSLEGIGWNALFMENHDQPRSVSVWGDDGVYLKESAKALSAVYFLMKGTPF
IYQGQELGMTNVAFPSIEDYDDVALKRLYETKTAKGTSHEDVMKIVWKKGRDNSRTPMQW
NAGPYAGFSEAKPWIGINENYKWLNAEAQKNDKTSVYHFYKSLIKLRQTYDVFINGTYEL
ILPEDQQIFAYLRKNESHTALIAANLTGTPALFRHSGLPLSSDALVLSNIETEPHKHMTS
VLLKPYEARIYLWC
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggcttggtggaaggaagccgtagtttaccaaatttacccccgcagttttaaa
gattcaaatggcgacggaatcggggatattcaaggaatcagaaccaagctttcttacata
aaagagctgggcgctgacgtcatatggatttgcccgctgtatgattcaccgaatgccgat
aatggctatgatatcagggattatcaaaacatattaagcgagtttggcacgatggaagat
tttgatgagctgcttggtgacattcatgatctggatatgaagctgattatggatctcgtt
gtgaaccacacaagcgacgaacatccatggttcatagaatcccgttcatccatacactcg
gaaaagcgcgactggtatatttggaaagacggcaaaaacggaaaaacgcccaacaattgg
gaaagcattttcggcgggccggcttgggagtatgatcaaaagacaagccagtattatctg
cacctttttgataaaaaacagcctgatttgaattgggaaaatgaaaaggtgaggaatgcc
gtttatgacatgatcaattggtggcttgataaaggaattgacggatttcgggtggatgcc
attacgcatattaagaaaaaagaagggtttcctgacatgccgaatccaaagggactggac
tatgtcccttcctttccttatcatatgaatgctgacggcattatggatttgttaacagag
ctgaaggaaaacacattttcccgctatccgattatgacagttggtgaagcaaacggcgtc
gctgcaaaagaagcagctgattgggctggagaaaaaaacggcatattcagcatgattttt
caatttgagcatctcggcctgtgggatgtagagatcaatgaaagtattgatatcgttgca
tttaaacgaattttaactgactggcaggacagtctggaagggatcggctggaatgctttg
tttatggagaatcacgaccagccccgttcagtttctgtgtggggagacgacggagtgtac
ctgaaagaaagtgcaaaagcgctttccgctgtttattttctcatgaaaggcacaccgttt
atttatcagggacaggaactcgggatgacgaacgtggcttttccatctattgaggactat
gatgatgtcgcattgaaacgcctgtatgaaacaaaaacagcgaaaggcacatcacacgag
gatgtgatgaagattgtctggaaaaagggaagagacaattcgcgaacgccgatgcaatgg
aatgctggtccatacgccggattttctgaggccaaaccgtggatcggaatcaatgagaat
tacaaatggctgaatgccgaggcgcaaaaaaacgataaaacatccgtttaccatttttac
aaaagcttgatcaagctgcgccaaacatatgatgtttttattaacgggacatacgagctc
attttaccggaagatcagcaaatctttgcatatcttcggaaaaacgagagccatactgca
ctgattgcggccaatctgacaggaacaccggcgttgttcaggcactctggattgccattg
tcatcagatgcactcgtcttgtcaaatattgaaacagagccgcacaagcatatgacatca
gtactcttaaagccgtatgaagcaagaatatatctatggtgctaa

DBGET integrated database retrieval system