KEGG   Bacillus subtilis subsp. subtilis 168: BSU31300Help
Entry
BSU31300          CDS       T00010                                 

Gene name
yugS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF21 CBS CorC_HlyC
Motif
Other DBs
NCBI-GeneID: 937160
NCBI-ProteinID: NP_391008
Pasteur: BG12371
BSORF: BG12371
UniProt: O05241
Position
complement(3216163..3217452)
Genome map
AA seq 429 aa AA seqDB search
MLILQLIAIFVLIGITAVFVAAEFAIVKIRGSKINQLIESGDSRALAAHKIISNLDEYLS
ACQLGITITALGLGWLGEPTFERFLHPLFTMTGIPEPFNHIVTFVVAFIIVTFLHVVMGE
LAPKTVSIQKAEAVSLWIAKPLIWFYKITYPFIKALNGSASFLVKLFGFHSVKEHQVVIS
EEELRLILSESYEKGEINQSEFRYVNKIFEFDNRVAREIMIPRTEIAVISLEQSLEEAIH
HIINERYTRYPVIKDDKDHILGIINSKDMFKAYFLGQPIKLNQIMRPVIRVIESIPVQQL
LIRMQKERIHMAILVDEYGGTAGLVTVEDIIEEIVGEIRDEYDQDETPHILKKGEHHYVM
DGKALIDEVNDLLDIAIENEEIDTIAGWLLTQKMELKAGDVIHAEGCEFKILDAEDHHIR
FVEIKKTDF
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ttgcttattttacaattgatcgccatttttgttttgattggcattacggctgttttcgtt
gcagcggaatttgcgatcgtcaaaatcagaggttcaaaaatcaatcagctcatcgaaagc
ggtgacagccgagcactagccgcacataaaatcatctccaatcttgacgagtatttatca
gcctgccagctcgggattacgattacagccctcggccttgggtggcttggtgaacctaca
tttgaacgttttcttcatcccttatttacaatgacaggcataccggaaccgtttaaccac
attgtcacatttgtagttgcatttatcatcgtcacttttttgcatgtggtgatgggggag
cttgccccgaaaacggtttctattcaaaaagctgaagctgtaagcttatggattgcaaag
ccgctgatctggttttataaaatcacgtacccgtttattaaagcattaaacggctctgca
agttttcttgtgaaattgtttggctttcattcggtaaaggagcatcaggttgtcatcagc
gaagaggaactaaggctgatcctttctgaaagctatgaaaagggagaaatcaatcagtct
gaattccgctatgtaaataagatttttgaatttgacaaccgggtagcgagagagattatg
attccgcggacagaaattgcggttatctctctggagcagtcgcttgaagaggcaattcat
cacatcattaatgaacggtatacacgctaccctgtcatcaaagatgacaaggatcatatt
ttagggatcatcaacagcaaagatatgtttaaagcttattttctcggccagccgataaag
ctgaatcaaatcatgaggcccgttatcagagtcattgaaagcattcctgttcagcagctt
ttaatccgcatgcagaaggagcggattcacatggcgattcttgtcgatgaatacggggga
acggcggggcttgtcactgtagaggatattatcgaggaaatcgtcggggaaatccgcgat
gagtatgatcaggatgaaacaccgcacatcctgaaaaagggcgagcaccattatgtgatg
gatggaaaagcgctaatagacgaagtgaatgaccttctcgacattgcgattgaaaatgaa
gaaattgatacgattgcaggctggcttctaacgcaaaaaatggagctgaaagcaggggat
gtgatacacgcggagggctgtgaatttaaaatcctcgacgccgaagatcaccacatccgt
tttgtagaaataaaaaaaactgatttttga

DBGET integrated database retrieval system