KEGG   Bacillus subtilis subsp. subtilis 168: BSU31310Help
Entry
BSU31310          CDS       T00010                                 

Gene name
yugP
Definition
(RefSeq) membrane protease YugP
  KO
K06973  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU31310 (yugP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_peptidase_2 Peptidase_M10
Motif
Other DBs
NCBI-GeneID: 938850
NCBI-ProteinID: NP_391009
Pasteur: BG12370
BSORF: BG12370
UniProt: O05248
Position
complement(3217496..3218173)
Genome map
AA seq 225 aa AA seqDB search
MLFIFLTIAALGLSFWAQFKVKSNFEKYSKVEASSGRTGAETARRILDINGLYDVPVEPV
RGTLTDHYDPTRRVVRLSEPVYYGRSISAISVASHEVGHALQHQESYGALVLRHKIFPVV
NFASGVAPLLFLGGMLLGSLNLIGLGIILFSAAVFFQLITLPVEFNASSRAKQIIVSEGF
IRNNEENGVNKVLSAAALTYVAAALVSLFELLRFVMIFLNGRDEN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttatatttttaacaatagccgcattgggattgtcgttttgggcacaatttaaa
gtaaagagcaactttgaaaaatattcaaaagtggaagcctcaagcggacgtacaggggca
gaaacggcaagacggattttagatataaacggtctttacgacgtgccggtcgaaccggta
agaggcactttaacagaccattacgacccgacaagacgggtggtgcgtttatctgagccg
gtctattacggccgctcaatttccgccatatccgtagcttcccatgaagtcggacatgcc
ttgcagcatcaggagtcatatggtgcgcttgtgctgagacataaaatcttcccagtcgtg
aattttgcatccggtgtagctcctttgcttttcttaggaggcatgcttctcggcagcctg
aatttgatcgggcttggcatcatactgttttcagcggctgtctttttccagctgattaca
ttgcctgtcgaattcaatgcaagttcacgtgcgaagcagattattgtgtcagaaggattc
atccgaaacaatgaagaaaatggggtaaataaagtgctgagtgctgctgccttaacgtat
gtggccgccgccctggtttccctgtttgaactacttcgttttgtgatgattttcttaaac
ggtcgtgatgagaattaa

DBGET integrated database retrieval system