KEGG   Bacillus subtilis subsp. subtilis 168: BSU31319
Entry
BSU31319          CDS       T00010                                 

Gene name
yuzI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TMEM51
Other DBs
NCBI-GeneID: 8303062
NCBI-ProteinID: YP_003097777
UniProt: C0H3Q4 A0A6M4JMK5
Position
complement(3218215..3218478)
AA seq 87 aa
MTIFQRTIVVLIGTQLAASAVILFIFDLNSYNHFSGSFSWLHFLKELAGSFAFYLFSAGL
FFLLIGLCAPSRKKKRISVHEKENSLK
NT seq 264 nt   +upstreamnt  +downstreamnt
atgacgatctttcaaagaacgatcgtggttttaatcggtacgcagctggcggcatccgcg
gtgattttgtttattttcgatttgaattcatataatcacttttccggaagcttctcctgg
cttcattttctgaaagaactggccggcagtttcgccttttatttgttttcagcaggcctg
ttctttttgctgattggattgtgtgctccaagccggaagaaaaagcgcatttctgtacac
gagaaagaaaactcattaaaataa

DBGET integrated database retrieval system