KEGG   Bacillus subtilis subsp. subtilis 168: BSU31321Help
Entry
BSU31321          CDS       T00010                                 

Gene name
mstX
Definition
(RefSeq) protein mistic
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mistic DUF1664
Motif
Other DBs
NCBI-GeneID: 8303011
NCBI-ProteinID: YP_003097778
UniProt: Q5BU39
Structure
PDB: 

Position
3218525..3218857
Genome map
AA seq 110 aa AA seqDB search
MFCTFFEKHHRKWDILLEKSTGVMEAMKVTSEEKEQLSTAIDRMNEGLDAFIQLYNESEI
DEPLIQLDDDTAELMKQARDMYGQEKLNEKLNTIIKQILSISVSEEGEKE
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtacattttttgaaaaacatcaccggaagtgggacatactgttagaaaaaagc
acgggtgtgatggaagctatgaaagtgacgagtgaggaaaaggaacagctgagcacagca
atcgaccgaatgaatgaaggactggacgcgtttatccagctgtataatgaatcggaaatt
gatgaaccgcttattcagcttgatgatgatacagccgagttaatgaagcaggcccgagat
atgtacggccaggaaaagctaaatgagaaattaaatacaattattaaacagattttatcc
atctcagtatctgaagaaggagaaaaagaatga

DBGET integrated database retrieval system