KEGG   Bacillus subtilis subsp. subtilis 168: BSU31321
Entry
BSU31321          CDS       T00010                                 

Gene name
mstX
Definition
(RefSeq) protein mistic
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Mistic DUF1664 aRib
Other DBs
NCBI-GeneID: 8303011
NCBI-ProteinID: YP_003097778
UniProt: Q5BU39 A0A6M3ZKF6
Structure
PDB: 
1YGM

Position
3218525..3218857
AA seq 110 aa
MFCTFFEKHHRKWDILLEKSTGVMEAMKVTSEEKEQLSTAIDRMNEGLDAFIQLYNESEI
DEPLIQLDDDTAELMKQARDMYGQEKLNEKLNTIIKQILSISVSEEGEKE
NT seq 333 nt   +upstreamnt  +downstreamnt
atgttttgtacattttttgaaaaacatcaccggaagtgggacatactgttagaaaaaagc
acgggtgtgatggaagctatgaaagtgacgagtgaggaaaaggaacagctgagcacagca
atcgaccgaatgaatgaaggactggacgcgtttatccagctgtataatgaatcggaaatt
gatgaaccgcttattcagcttgatgatgatacagccgagttaatgaagcaggcccgagat
atgtacggccaggaaaagctaaatgagaaattaaatacaattattaaacagattttatcc
atctcagtatctgaagaaggagaaaaagaatga

DBGET integrated database retrieval system