KEGG   Bacillus subtilis subsp. subtilis 168: BSU31322Help
Entry
BSU31322          CDS       T00010                                 

Gene name
yugO
Definition
(RefSeq) potassium channel protein YugO
  KO
K10716  voltage-gated potassium channel
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU31322 (yugO)
Transporters [BR:bsu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSU31322 (yugO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_N Ion_trans_2 Ion_trans XPG_I_2 DUF1460 Spore_GerQ
Motif
Other DBs
NCBI-GeneID: 938842
NCBI-ProteinID: NP_391010
UniProt: Q795M8
Position
3218854..3219840
Genome map
AA seq 328 aa AA seqDB search
MKSNRIFISWLRWPLFIRIGVIILCLILLFGQIIYILEPKQFTSVFEGIWWAVVTVSTVG
YGDYVPHTPLGQAAGILLILSGASFVTAYFATLSAAAFSRQHRYIEGKVAYKGRDHIILI
GWNEKTNRLLKDLQLAAPSKTVVLIDESLTEGPLIENVHFIRGHAADDGTLKRANITEAE
SVMITADQYKSETDADMLSVLTLLSVKGLNPLAYCIVEILTDRFVTNAERAGANQIIGTS
EFISRAMLQHYQVKLRPSKQQNGIKLTLDQHVELLAVPDELKGAAYKTCVLYFLDHNTTI
IGIQKKEGPMLSPPLTYKVLETDQFLAI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaatcggatatttatttcatggctcaggtggccgttatttatccgaatcggg
gttattattttatgtctgattcttttgttcggccaaatcatttatatacttgagcctaag
cagttcacttcggtattcgaaggtatttggtgggctgtcgttacggtttctacagtcggt
tatggagactatgtgccgcacactccgctgggacaggcagccggaatactgctgattttg
agcggagcaagctttgtcacagcgtatttcgctacgttatcagcggccgcattcagcaga
cagcatcgctacattgaaggaaaagttgcttacaaaggccgggaccacatcattctgatc
gggtggaatgaaaaaacaaaccggcttttgaaggaccttcagcttgccgccccttccaaa
acagtcgtactaatcgatgaatccttaacagaaggcccgcttattgaaaacgttcatttc
atacgcgggcacgctgccgatgatgggacactgaaacgggccaatattactgaagcggaa
tcagtgatgattactgccgatcagtataaaagtgaaactgatgctgatatgctgtcagtg
ctgactcttttatctgttaaaggtcttaatccccttgcttactgcatcgtcgagatttta
actgaccgttttgtcaccaatgcggaacgggcaggcgcaaaccaaatcatcggaacttca
gaatttatcagccgggcgatgctgcagcattaccaagtcaagttacggccgtctaaacag
cagaacggaatcaagctgacacttgatcagcatgtggagcttcttgctgttcctgacgaa
ctaaagggagcggcttacaaaacctgtgttctctatttccttgatcacaacacaacaatt
ataggcatacaaaaaaaggaggggccgatgctttcccctcctcttacatacaaggtgctc
gaaacagatcaattccttgccatctag

DBGET integrated database retrieval system