KEGG   Bacillus subtilis subsp. subtilis 168: BSU31330Help
Entry
BSU31330          CDS       T00010                                 

Gene name
yugN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YugN
Motif
Other DBs
NCBI-GeneID: 938845
NCBI-ProteinID: NP_391011
Pasteur: BG12368
BSORF: BG12368
UniProt: O05246
Position
complement(3219837..3220241)
Genome map
AA seq 134 aa AA seqDB search
MIPIPSAIDGQSFLLQELEQVMKPLGYVINGGWEYDHGYFDYKIDDRDGYLFLRIPVNAV
QGSLDERGAAVRIGTPFMLRQVFQADVDDHAEGGPFQSLFNQFSEPERRDAEIDPAFLDI
GASLVKELEDVLLH
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgataccaataccttccgcgatagatgggcagtcttttctgcttcaagaactggaacaa
gtgatgaagccgctcggttatgtgataaacggcggctgggaatacgatcatggctacttt
gattataaaattgatgatagagacggctatttatttttaagaattcccgtcaatgcggta
cagggcagtctcgatgaacgaggggcggccgtccggatcggaacgccatttatgctgaga
caggtgtttcaggcggatgttgacgatcacgccgagggagggcctttccaatcactgttt
aatcaattttccgaaccggaaaggcgggacgcggaaattgatccggcatttttggatatc
ggcgcctctctcgtgaaagaattggaggatgttctgttacactag

DBGET integrated database retrieval system