KEGG   Bacillus subtilis subsp. subtilis 168: BSU31340Help
Entry
BSU31340          CDS       T00010                                 

Gene name
yugM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VMA21 Tom22
Motif
Other DBs
NCBI-GeneID: 937159
NCBI-ProteinID: NP_391012
Pasteur: BG12367
BSORF: BG12367
UniProt: O05245
Position
complement(3220301..3220672)
Genome map
AA seq 123 aa AA seqDB search
MFMKQLVKHLIIAGFSAAILSFLISFDAVYTGFSSSFGGTLSHFFIHSFLLIGLPLALFT
DAVHRILHLKRTHTLFTKLGLYATVVYVSWDSAVWLAAAMAVYFLIECAFFPVGRAKETT
ISM
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgttcatgaaacaattggttaaacatctcatcattgccggtttttctgcagctatttta
agtttccttatctcctttgatgccgtgtatacagggttttcttcaagctttggcggcacg
ctgtcacattttttcatccactcctttcttctcattggtttgccgcttgccctttttacc
gatgcggtacatcggattttgcatttaaaacgaacccatactcttttcactaaattagga
ctctatgcaacggttgtttatgtgtcttgggattcagctgtatggcttgcagcggcaatg
gctgtttacttcttaattgaatgcgctttctttcctgttggccgcgcgaaagaaacaacg
atttccatgtag

DBGET integrated database retrieval system