KEGG   Bacillus subtilis subsp. subtilis 168: BSU31350Help
Entry
BSU31350          CDS       T00010                                 

Gene name
pgi
Definition
(RefSeq) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00030  Pentose phosphate pathway
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Module
bsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU31350 (pgi)
   00030 Pentose phosphate pathway
    BSU31350 (pgi)
   00500 Starch and sucrose metabolism
    BSU31350 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU31350 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU31350 (pgi)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     BSU31350 (pgi)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BSU31350 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   BSU31350 (pgi)
  Exosomal proteins of colorectal cancer cells
   BSU31350 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 937165
NCBI-ProteinID: NP_391013
Pasteur: BG12366
BSORF: BG12366
UniProt: P80860
Position
complement(3220731..3222083)
Genome map
AA seq 450 aa AA seqDB search
MTHVRFDYSKALTFFNEHELTYLRDFVKTAHHNIHEKTGAGSDFLGWVDLPEHYDKEEFA
RIKKSAEKIKSDSDVLLVVGIGGSYLGARAAIEALNHAFYNTLPKAKRGNPQVIFIGNNI
SSSYMRDVMDLLEDVDFSINVISKSGTTTEPAIAFRIFRKLLEEKYGKEEAKARIYATTD
KERGALKTLSNEEGFESFVIPDDVGGRYSVLTAVGLLPIAVSGVNIDDMMKGALDASKDF
ATSELEDNPAYQYAVVRNVLYNKGKTIEMLINYEPALQYFAEWWKQLFGESEGKDEKGIY
PSSANYSTDLHSLGQYVQEGRRDLFETVLNVEKPKHELTIEEADNDLDGLNYLAGKTVDF
VNKKAFQGTMLAHTDGNVPNLIVNIPELNAYTFGYLVYFFEKACAMSGYLLGVNPFDQPG
VEAYKVNMFALLGKPGFEEKKAELEKRLED
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatgtacgctttgactactcaaaagcgttgactttcttcaacgaacatgaactt
acatacctgcgggactttgtaaaaacagcacaccataatatccatgagaaaacaggcgcg
ggcagcgattttctaggctgggtggacctccctgaacattatgataaagaagaattcgcg
cgcatcaaaaaaagcgcggaaaaaatcaaatctgactctgatgtcttgcttgttgtcggc
atcggcggttcttatcttggagcgcgggcagcgattgaagcgctgaatcacgcgttttat
aacactttgccaaaagcaaaacgcggcaatccgcaagtcatttttatcgggaacaacatc
agttcatcttatatgagagacgtcatggatcttcttgaagatgttgacttctctattaat
gtgatttctaaatcaggtacgacaactgaacctgcaatcgctttccgtattttccgcaag
cttcttgaagagaaatacggtaaagaagaagcgaaagcgcggatttatgcaacaactgat
aaagagcgcggcgcattaaaaacgctttctaacgaagaaggctttgaatcattcgtaatt
cctgacgatgtcggcggccgttattcagttttaacagctgtaggtctcttgccgattgct
gtcagcggcgtcaacattgacgacatgatgaaaggcgccctggatgcgagcaaagatttt
gcaacatctgaactggaagataacccagcataccaatatgcggttgttcgcaatgtcctt
tataataagggcaaaacaattgaaatgctcatcaactacgaaccggcgcttcaatacttt
gcggaatggtggaagcagctgttcggagaaagcgaagggaaagatgagaagggcatttat
ccttcttcagcgaactattcaacagaccttcattctttaggccagtatgtacaagaaggc
cgcagagatttattcgaaacggtcctgaacgtagagaagcctaaacatgaactgacaatt
gaggaagcggataacgatcttgacggcttgaactatttagccggtaaaactgttgatttc
gttaacaaaaaagcattccaaggtacaatgcttgcccatacagacggaaatgttccgaac
ttaatcgttaacattcctgagctgaatgcatatacttttggataccttgtatatttcttc
gaaaaagcctgcgcgatgagcggttacctccttggcgtcaatccgtttgaccagcctggt
gtagaagcgtataaagtcaatatgtttgcgttactcggcaaacctggctttgaagagaaa
aaagcagagcttgaaaaacgtctggaagattaa

DBGET integrated database retrieval system