KEGG   Bacillus subtilis subsp. subtilis 168: BSU31360
Entry
BSU31360          CDS       T00010                                 

Symbol
yugK
Name
(RefSeq) NADH-dependent butanol dehydrogenase 2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2
Other DBs
NCBI-GeneID: 938844
NCBI-ProteinID: NP_391014
Pasteur: BG12365
BSORF: BG12365
UniProt: O05240 A0A6M4JLE9
Position
complement(3222195..3223367)
AA seq 390 aa
MENFTYYNPTKLIFGKGQLEQLRKEFKRYGKNVLLVYGGGSIKRNGLYDQVTGILKEEGA
VVHELSGVEPNPRLATVEKGIGLCREHDIDFLLAVGGGSVIDCTKAIAAGVKYDGDAWDI
FSKKVTAEDALPFGTVLTLAATGSEMNPDSVITNWETNEKFVWGSNVTHPRFSILDPENT
FTVPENQTVYGMVDMMSHVFEQYFHNVENTPLQDRMCFAVLQTVIETAPKLLEDLENYEL
RETILYAGTIALNGTLQMGYFGDWASHTMEHAVSAVYDIPHAGGLAILFPNWMRYTLDTN
VGRFKNLMLNMFDIDTEGKTDKEIALEGIDKLSAFWTSLGAPSRLADYNIGEEKLELIAD
IAAKEMEHGGFGNFQKLNKDDVLAILRASL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggaaaatttcacttattataatccgacaaagctgatttttggaaaaggtcagcttgaa
caattaagaaaagaattcaaacgatacggcaagaatgtactgcttgtttacgggggcggc
agcattaaacgcaacggcctttatgatcaagtcacaggcattttaaaagaagagggcgct
gttgttcatgagctgtcaggtgtagagccaaacccgcgtcttgcgacagtggaaaaaggc
ataggactttgcagagagcatgacattgattttctgcttgctgtcggcggaggcagtgtg
attgactgtacaaaggcaatcgcagctggcgtcaaatatgacggtgacgcttgggatatt
ttcagcaaaaaagtaacagcggaggatgcgctgccgtttggcactgttttaactcttgct
gcaacagggtctgaaatgaaccctgattccgtgattacaaactgggaaacaaacgagaaa
tttgtatggggcagcaatgtcactcatccgcgtttctctattttagaccctgaaaatacg
ttcaccgttccagaaaatcaaacagtatacggcatggttgacatgatgagccacgtattc
gaacaatacttccataatgttgaaaacacgccgcttcaggatagaatgtgctttgctgtt
ttgcagacggtcatcgaaacagctcctaagcttcttgaagatctggaaaactacgaactt
cgtgaaacgattttgtatgctggtactattgctttaaacggcacgctccaaatgggatac
ttcggtgactgggcttctcatacaatggaacacgctgtttcagctgtatatgatattccg
cacgcgggcggtttggcaatactgttcccaaattggatgagatacacgcttgatacaaat
gtaggccgttttaaaaaccttatgctcaacatgtttgacattgatactgaaggcaaaaca
gataaagaaattgcgcttgaaggaatcgataaactgtctgcgttctggacaagcctcggt
gcaccttctcgtcttgctgattacaatattggagaagaaaagcttgagctgattgctgat
atcgcagccaaggaaatggaacacggcggcttcggcaacttccaaaaactgaacaaagat
gacgtgcttgccatccttcgcgcgtctctataa

DBGET integrated database retrieval system